Recombinant Human CENPE Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CENPE Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-111 of Human CENPE partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TPVSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRKEIMDLKKQLEEVSLETRAQAMEKDQLAQLLEEKDLLQKVQNEKIENLTRMLVTSSSLTLQQELKAKRKR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CENPE
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CENPE Protein

  • CENP-E
  • Centromere autoantigen E (312kD)
  • centromere protein E (312kD)
  • Centromere protein E
  • centromere protein E, 312kDa
  • centromere-associated protein E
  • KIF10
  • kinesin family member 10
  • Kinesin-related protein CENPE

Background

CENPE - centromere protein E, 312kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
AF4185
Species: Hu
Applications: ICC
NB100-2369
Species: Hu
Applications: ICC/IF, IHC
NBP2-55474
Species: Hu
Applications: ICC/IF
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB500-101
Species: Hu, Bv
Applications: WB, Flow, ICC/IF, IP
NBP2-01064
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CENPE Partial Recombinant Protein (H00001062-Q01) (0)

There are no publications for CENPE Partial Recombinant Protein (H00001062-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPE Partial Recombinant Protein (H00001062-Q01) (0)

There are no reviews for CENPE Partial Recombinant Protein (H00001062-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CENPE Partial Recombinant Protein (H00001062-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CENPE Products

CENPE H00001062-Q01

Bioinformatics Tool for CENPE Partial Recombinant Protein (H00001062-Q01)

Discover related pathways, diseases and genes to CENPE Partial Recombinant Protein (H00001062-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENPE Partial Recombinant Protein (H00001062-Q01)

Discover more about diseases related to CENPE Partial Recombinant Protein (H00001062-Q01).
 

Pathways for CENPE Partial Recombinant Protein (H00001062-Q01)

View related products by pathway.

PTMs for CENPE Partial Recombinant Protein (H00001062-Q01)

Learn more about PTMs related to CENPE Partial Recombinant Protein (H00001062-Q01).
 

Research Areas for CENPE Partial Recombinant Protein (H00001062-Q01)

Find related products by research area.

Blogs on CENPE.

CENPF Antibodies as Potential Cancer Markers
Centromere protein F (CENPF), also named mitosin, is a large human protein of 3113 amino acid residues. Its expression and localization are cell cycle-dependent. The protein levels are low in G1 phase but elevated from S to early M phase. CENPF is a n...  Read full blog post.

Customers Who Bought This Also Bought

CENPF Antibody
NB500-101
CENPE Antibody
NBP1-82875

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CENPE Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPE