CDYL2 Antibody (NBP1-83470)

Images

 
Immunohistochemistry: CDYL2 Antibody [NBP1-83470] - Immunohistochemical staining of human rectum shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDYL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHMSKDKRIKSGKQSSTSKLLRDSRGPSVEKLSHRPSDPGKSKGTSHKRKRINPPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDYL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
CDYL2 Protein (NBP1-83470PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDYL2 Antibody

  • CDY-like 2
  • chromodomain protein, Y-like 2
  • chromodomain Y-like protein 2
  • FLJ38866

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009426-R01
Species: Hu
NBP2-34011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-40825
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00008361-R01
Species: Hu
H00008360-R01
Species: Hu
H00008363-P01
Species: Hu
H00008294-P01
Species: Hu
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
H00008362-P01
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-40343
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20322
Species: Hu
Applications: WB, ChIP, IP
NBP2-16847
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74597
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83470
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CDYL2 Antibody (NBP1-83470) (0)

There are no publications for CDYL2 Antibody (NBP1-83470).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDYL2 Antibody (NBP1-83470) (0)

There are no reviews for CDYL2 Antibody (NBP1-83470). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDYL2 Antibody (NBP1-83470) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDYL2 Antibody Products

Related Products by Gene

Bioinformatics Tool for CDYL2 Antibody (NBP1-83470)

Discover related pathways, diseases and genes to CDYL2 Antibody (NBP1-83470). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDYL2 Antibody (NBP1-83470)

Discover more about diseases related to CDYL2 Antibody (NBP1-83470).
 

Pathways for CDYL2 Antibody (NBP1-83470)

View related products by pathway.

PTMs for CDYL2 Antibody (NBP1-83470)

Learn more about PTMs related to CDYL2 Antibody (NBP1-83470).

Blogs on CDYL2

There are no specific blogs for CDYL2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDYL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDYL2

Customers Who Bought This Also Bought