Recombinant Human CDX4 Protein

Images

 
SDS-Page: Recombinant Human CDX4 Protein [H00001046-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human CDX4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 71-170 of Human CDX4

Source: Wheat Germ

Amino Acid Sequence: VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDX4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDX4 Protein

  • caudal type homeo box transcription factor 4
  • caudal type homeobox 4
  • caudal type homeobox transcription factor 4
  • Caudal-type homeobox protein 4
  • CDX4
  • homeobox protein CDX-4

Background

CDX4 - caudal type homeo box transcription factor 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-49538
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
NBP2-58252
Species: Hu
Applications: WB, ICC/IF
NBP2-05480
Species: Hu
NBL1-11664
Species: Hu
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47492
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84079
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC

Publications for CDX4 Partial Recombinant Protein (H00001046-Q01) (0)

There are no publications for CDX4 Partial Recombinant Protein (H00001046-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDX4 Partial Recombinant Protein (H00001046-Q01) (0)

There are no reviews for CDX4 Partial Recombinant Protein (H00001046-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDX4 Partial Recombinant Protein (H00001046-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for CDX4 Partial Recombinant Protein (H00001046-Q01)

Discover related pathways, diseases and genes to CDX4 Partial Recombinant Protein (H00001046-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDX4 Partial Recombinant Protein (H00001046-Q01)

Discover more about diseases related to CDX4 Partial Recombinant Protein (H00001046-Q01).
 

Pathways for CDX4 Partial Recombinant Protein (H00001046-Q01)

View related products by pathway.

PTMs for CDX4 Partial Recombinant Protein (H00001046-Q01)

Learn more about PTMs related to CDX4 Partial Recombinant Protein (H00001046-Q01).

Blogs on CDX4

There are no specific blogs for CDX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CDX4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDX4
Entrez