CDR2 Antibody - BSA Free

Western Blot: CDR2 Antibody [NBP1-84561] - Analysis using Anti-CDR2 antibody NBP1-84561 (A) shows similar pattern to independent antibody NBP1-84562 (B).

Immunocytochemistry/Immunofluorescence: CDR2 Antibody [NBP1-84561] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Analysis in human cell line HepG2.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CDR2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CDR2 Antibody - BSA Free (NBP1-84561) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-CDR2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CDR2 Protein (NBP1-84561PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%). Reactivity reported in scientific literature (PMID: 23823982)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CDR2 Antibody - BSA Free

• CDR62
• cerebellar degeneration-related protein (62kD)
• cerebellar degeneration-related protein 2
• cerebellar degeneration-related protein 2, 62kDa
• Major Yo paraneoplastic antigen
• Paraneoplastic cerebellar degeneration-associated antigen
• PCD17
• Yo paraneoplastic antigen
• Yo

Background

CDR2 suppresses the transcriptional activity and DNA binding of nuclear factor-kappa B by an unknown mechanism. The neuron specific expression of CDR-2 is regulated by a post-transcriptional mechanism. CDR2 antibodies are useful tools for transcription regulation and neurology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CDR2 Antibody (NBP1-84561)(2)

Publications using NBP1-84561

• Schubert M, Panja D, Haugen M et al. Paraneoplastic CDR2 and CDR2L antibodies affect Purkinje cell calcium homeostasis. Acta Neuropathol 2014-12-01 [PMID: 25341622]
• Eichler TW, Totland C, Haugen M et al. CDR2L Antibodies: A New Player in Paraneoplastic Cerebellar Degeneration. PLoS One 2013-01-01 [PMID: 23823982]

FAQs for CDR2 Antibody (NBP1-84561). (Showing 1 - 1 of 1 FAQs).

1. I'm looking for an antibody against human CDR2 to recognize thymic epithelial cells. You have several anti CDR2 antibodies. Are they against a thymic epithelial antigen or against the cerebellar degeneration-related protein 2, 62kDa?
   • Yes, the specific antibody you have inquired about is against cerebellar degeneration-related protein 2, 62 kDa. Moreover, all of our CDR2 primaries are against the same target.

Bioinformatics

• Gene Symbol: CDR2