CDKL1 Antibody (2H6)

Images

 
Immunocytochemistry/ Immunofluorescence: CDKL1 Antibody (2H6) [H00008814-M05] - Analysis of monoclonal antibody to CDKL1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: CDKL1 Antibody (2H6) [H00008814-M05] - Analysis of monoclonal antibody to CDKL1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 5 ug/ml
ELISA: CDKL1 Antibody (2H6) [H00008814-M05] - Detection limit for recombinant GST tagged CDKL1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CDKL1 Antibody (2H6) Summary

Immunogen
CDKL1 (NP_004187 259 a.a. - 358 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI
Specificity
CDKL1 - cyclin-dependent kinase-like 1 (CDC2-related kinase)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDKL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDKL1 Antibody (2H6)

  • CDC2-related kinase 1
  • cyclin-dependent kinase-like 1 (CDC2-related kinase)
  • cyclin-dependent kinase-like 1
  • EC 2.7.11
  • EC 2.7.11.22
  • KKIALRE
  • P42
  • Protein kinase p42 KKIALRE
  • serine/threonine protein kinase KKIALRE
  • Serine/threonine-protein kinase KKIALRE

Background

This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Alternative splice variants encoding different protein isoforms have been described, but their full-length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDKL1 Antibody (H00008814-M05) (0)

There are no publications for CDKL1 Antibody (H00008814-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDKL1 Antibody (H00008814-M05) (0)

There are no reviews for CDKL1 Antibody (H00008814-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDKL1 Antibody (H00008814-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDKL1 Products

Bioinformatics Tool for CDKL1 Antibody (H00008814-M05)

Discover related pathways, diseases and genes to CDKL1 Antibody (H00008814-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDKL1 Antibody (H00008814-M05)

Discover more about diseases related to CDKL1 Antibody (H00008814-M05).
 

Pathways for CDKL1 Antibody (H00008814-M05)

View related products by pathway.

PTMs for CDKL1 Antibody (H00008814-M05)

Learn more about PTMs related to CDKL1 Antibody (H00008814-M05).
 

Research Areas for CDKL1 Antibody (H00008814-M05)

Find related products by research area.

Blogs on CDKL1

There are no specific blogs for CDKL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDKL1 Antibody (2H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKL1
Entrez
OMIM
Uniprot