CDK8 Recombinant Protein Antigen

Images

 
There are currently no images for CDK8 Recombinant Protein Antigen (NBP2-55134PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDK8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDK8.

Source: E. coli

Amino Acid Sequence: LTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDK8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55134.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDK8 Recombinant Protein Antigen

  • CDK8 protein kinase
  • CDK8
  • Cell division protein kinase 8
  • cyclin-dependent kinase 8
  • EC 2.7.11
  • EC 2.7.11.22
  • EC 2.7.11.23
  • K35
  • Mediator complex subunit CDK8
  • Mediator of RNA polymerase II transcription subunit CDK8
  • MGC126074
  • MGC126075
  • Protein kinase K35

Background

Cdk8 is encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the 'Mediator-like' protein complexes and the basal transcription machinery.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92902
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-15345
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-581
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
NB100-60642
Species: Hu, Pm
Applications: IP, WB
NB100-2357
Species: Hu, Mu, Pm
Applications: ChIP, IHC,  IHC-P, IP, WB
H00000902-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-2574
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NB200-337
Species: Hu, Mu
Applications: ChIP, IP, WB (-)
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
NBP3-46159
Species: Hu, Mu, Rt
Applications: ELISA, IHC
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP2-87539
Species: Hu
Applications: IHC,  IHC-P, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-55134PEP
Species: Hu
Applications: AC

Publications for CDK8 Recombinant Protein Antigen (NBP2-55134PEP) (0)

There are no publications for CDK8 Recombinant Protein Antigen (NBP2-55134PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDK8 Recombinant Protein Antigen (NBP2-55134PEP) (0)

There are no reviews for CDK8 Recombinant Protein Antigen (NBP2-55134PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDK8 Recombinant Protein Antigen (NBP2-55134PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDK8 Products

Research Areas for CDK8 Recombinant Protein Antigen (NBP2-55134PEP)

Find related products by research area.

Blogs on CDK8.

Notch1 - A multifunctional transmembrane receptor
Notch1 is a member of the Notch family of Type 1 single-pass transmembrane proteins that share an extracellular domain of multiple epidermal growth factor-like (EGF) repeats. Notch family members play key roles in a variety of developmental process...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDK8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK8