Recombinant Human CDK8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CDK8 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-90 of Human CDK8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY

Protein/Peptide Type
Partial Recombinant Protein
Gene
CDK8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDK8 Protein

  • CDK8 protein kinase
  • CDK8
  • Cell division protein kinase 8
  • cyclin-dependent kinase 8
  • EC 2.7.11
  • EC 2.7.11.22
  • EC 2.7.11.23
  • K35
  • Mediator complex subunit CDK8
  • Mediator of RNA polymerase II transcription subunit CDK8
  • MGC126074
  • MGC126075
  • Protein kinase K35

Background

CDK8 - cyclin-dependent kinase 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-18878
Species: Hu
Applications: WB, IHC-P, IP
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-581
Species: Hu
Applications: WB, IHC, IP, PLA
NB100-60642
Species: Hu
Applications: WB, IP
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NB200-338
Species: Hu, Mu
Applications: WB (-), IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBL1-11392
Species: Hu
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CDK8 Partial Recombinant Protein (H00001024-Q01) (0)

There are no publications for CDK8 Partial Recombinant Protein (H00001024-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDK8 Partial Recombinant Protein (H00001024-Q01) (0)

There are no reviews for CDK8 Partial Recombinant Protein (H00001024-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDK8 Partial Recombinant Protein (H00001024-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDK8 Products

Bioinformatics Tool for CDK8 Partial Recombinant Protein (H00001024-Q01)

Discover related pathways, diseases and genes to CDK8 Partial Recombinant Protein (H00001024-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDK8 Partial Recombinant Protein (H00001024-Q01)

Discover more about diseases related to CDK8 Partial Recombinant Protein (H00001024-Q01).
 

Pathways for CDK8 Partial Recombinant Protein (H00001024-Q01)

View related products by pathway.

PTMs for CDK8 Partial Recombinant Protein (H00001024-Q01)

Learn more about PTMs related to CDK8 Partial Recombinant Protein (H00001024-Q01).
 

Research Areas for CDK8 Partial Recombinant Protein (H00001024-Q01)

Find related products by research area.

Blogs on CDK8.

Notch1 - A multifunctional transmembrane receptor
Notch1 is a member of the Notch family of Type 1 single-pass transmembrane proteins that share an extracellular domain of multiple epidermal growth factor-like (EGF) repeats. Notch family members play key roles in a variety of developmental process...  Read full blog post.

Customers Who Bought This Also Bought

CDK8 Antibody (5H4)
H00001024-M03

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CDK8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK8
Entrez