Cdk6 Antibody - BSA Free

Western Blot: Cdk6 Antibody [NBP2-92967] - analysis of lysates from HeLa cells, using CDK6 Rabbit pAb at 1:900 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25Ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 30s.

Immunohistochemistry-Paraffin-Cdk6 Antibody - Azide and BSA Free-NBP2-92967-y analysis of CDK6 inparaffin-embedded human coloncarcinoma using CDK6 Rabbit pAb at dilution of 1:100 (40x lens).Perform highpressure antigen retrieval with 10 mMcitrate buffer pH 6.0 before commencingwith IHC staining protocol.

Immunoprecipitation-Cdk6 Antibody - Azide and BSA Free-NBP2-92967-Analysis of 200 μg extracts of Jurkat cells, using 3 μg CDK6 antibody.Western blot was performed from the immunoprecipitate using CDK6 antibody at a dilutionof 1:1000.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cdk6 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 226-326 of human Cdk6 (NP_001250.1). DQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDK6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 0.5μg-4μg
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cdk6 Antibody - BSA Free

• Cdk6
• CDKN6
• Cell division protein kinase 6
• cyclin-dependent kinase 6
• EC 2.7.11
• EC 2.7.11.22
• PLSTIREMGC59692
• Serine/threonine-protein kinase PLSTIRE

Background

Cdk6 is encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cdk6 Antibody (NBP2-92967)(1)

Publication using NBP2-92967

• Qu J, Ke F, Liu Z et al. Uncovering the mechanisms of dandelion against triple-negative breast cancer using a combined network pharmacology, molecular pharmacology and metabolomics approach Phytomedicine : international journal of phytotherapy and phytopharmacology 2022-02-11 [PMID: 35183931] (WB, Mouse)

Bioinformatics

• Gene Symbol: CDK6