Western Blot: Cdk6 Antibody [NBP2-92967] - analysis of lysates from HeLa cells, using CDK6 Rabbit pAb at 1:900 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25Ug per ...read more
Immunohistochemistry-Paraffin-Cdk6 Antibody - Azide and BSA Free-NBP2-92967-y analysis of CDK6 inparaffin-embedded human coloncarcinoma using CDK6 Rabbit pAb at dilution of 1:100 (40x lens).Perform highpressure antigen ...read more
Immunoprecipitation-Cdk6 Antibody - Azide and BSA Free-NBP2-92967-Analysis of 200 μg extracts of Jurkat cells, using 3 μg CDK6 antibody.Western blot was performed from the immunoprecipitate using CDK6 antibody at a ...read more
Novus Biologicals Rabbit Cdk6 Antibody - BSA Free (NBP2-92967) is a polyclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. Anti-Cdk6 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 226-326 of human Cdk6 (NP_001250.1). DQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
37 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP2-92967 in the following applications:
Cdk6 is encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Cdk6 Antibody - BSA Free and receive a gift card or discount.