Cdk3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cdk3 Antibody [NBP1-86496] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: Cdk3 Antibody [NBP1-86496] - Staining of human kidney shows strong nuclear and cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cdk3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cdk3 Protein (NBP1-86496PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cdk3 Antibody

  • Cell division protein kinase 3
  • cyclin-dependent kinase 3
  • EC 2.7.11
  • EC 2.7.11.22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-18878
Species: Hu
Applications: WB, IHC-P, IP
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56016
Species: Hu
Applications: WB, ICC/IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-46085
Species: Hu
Applications: WB, IHC
AF6897
Species: Hu, Mu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86496
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Cdk3 Antibody (NBP1-86496) (0)

There are no publications for Cdk3 Antibody (NBP1-86496).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdk3 Antibody (NBP1-86496) (0)

There are no reviews for Cdk3 Antibody (NBP1-86496). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cdk3 Antibody (NBP1-86496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdk3 Products

Bioinformatics Tool for Cdk3 Antibody (NBP1-86496)

Discover related pathways, diseases and genes to Cdk3 Antibody (NBP1-86496). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdk3 Antibody (NBP1-86496)

Discover more about diseases related to Cdk3 Antibody (NBP1-86496).
 

Pathways for Cdk3 Antibody (NBP1-86496)

View related products by pathway.

PTMs for Cdk3 Antibody (NBP1-86496)

Learn more about PTMs related to Cdk3 Antibody (NBP1-86496).
 

Research Areas for Cdk3 Antibody (NBP1-86496)

Find related products by research area.

Blogs on Cdk3

There are no specific blogs for Cdk3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdk3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK3