CDC45L Recombinant Protein Antigen

Images

 
There are currently no images for CDC45L Protein (NBP1-85723PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDC45L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC45.

Source: E. coli

Amino Acid Sequence: MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFHYFILINCGANVDLLDILQPDEDTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC45
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85723.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDC45L Recombinant Protein Antigen

  • CDC45 cell division cycle 45-like (S. cerevisiae)
  • cell division cycle 45 homolog (S. cerevisiae)
  • cell division cycle 45-like 2
  • human CDC45
  • S.cerevisiae, homolog)-like

Background

CDC45L is encoded by this gene was identified by its strong similarity with Saccharomyces cerevisiae Cdc45, an essential protein required to the initiation of DNA replication. Cdc45 is a member of the highly conserved multiprotein complex including Cdc6/Cdc18, the minichromosome maintenance proteins (MCMs) and DNA polymerase, which is important for early steps of DNA replication in eukaryotes. This protein has been shown to interact with MCM7 and DNA polymerase alpha. Studies of the similar gene in Xenopus suggested that this protein play a pivotal role in the loading of DNA polymerase alpha onto chromatin. Multiple polyadenlyation sites of this gene are reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004176-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-32708
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-288
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-15837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-92102
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-33105
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NB100-79778
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-41181
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, Simple Western, WB
NB100-2567
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NBP2-33825
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for CDC45L Protein (NBP1-85723PEP) (0)

There are no publications for CDC45L Protein (NBP1-85723PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC45L Protein (NBP1-85723PEP) (0)

There are no reviews for CDC45L Protein (NBP1-85723PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDC45L Protein (NBP1-85723PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC45L Products

Research Areas for CDC45L Protein (NBP1-85723PEP)

Find related products by research area.

Blogs on CDC45L

There are no specific blogs for CDC45L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDC45L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC45