CDC42SE2 Antibody

Images

 
Western Blot: CDC42SE2 Antibody [NBP1-82131] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: CDC42SE2 Antibody [NBP1-82131] - Staining of human skeletal muscle shows low expression as expected.
Western Blot: CDC42SE2 Antibody [NBP1-82131] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CDC42SE2 Antibody [NBP1-82131] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells along with strong positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: CDC42SE2 Antibody [NBP1-82131] - Staining in human lymph node and skeletal muscle tissues using anti-CDC42SE2 antibody. Corresponding CDC42SE2 RNA-seq data are presented for the same ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDC42SE2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
Specificity
Specificity of human, mouse, rat CDC42SE2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC42SE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CDC42SE2 Protein (NBP1-82131PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDC42SE2 Antibody

  • CDC42 small effector 2
  • FLJ21967
  • non-kinase Cdc42 effector protein SPEC2
  • Small effector of CDC42 protein 2
  • SPEC2CDC42 small effector protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80780
Species: Hu
Applications: IHC, IHC-P
H00051735-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-31329
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-83257
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85260
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-57641
Species: Hu
Applications: WB, ICC/IF

Publications for CDC42SE2 Antibody (NBP1-82131) (0)

There are no publications for CDC42SE2 Antibody (NBP1-82131).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42SE2 Antibody (NBP1-82131) (0)

There are no reviews for CDC42SE2 Antibody (NBP1-82131). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC42SE2 Antibody (NBP1-82131) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CDC42SE2 Antibody (NBP1-82131)

Discover related pathways, diseases and genes to CDC42SE2 Antibody (NBP1-82131). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC42SE2 Antibody (NBP1-82131)

Discover more about diseases related to CDC42SE2 Antibody (NBP1-82131).
 

Pathways for CDC42SE2 Antibody (NBP1-82131)

View related products by pathway.

PTMs for CDC42SE2 Antibody (NBP1-82131)

Learn more about PTMs related to CDC42SE2 Antibody (NBP1-82131).
 

Research Areas for CDC42SE2 Antibody (NBP1-82131)

Find related products by research area.

Blogs on CDC42SE2

There are no specific blogs for CDC42SE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC42SE2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42SE2