CDC42EP1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CDC42EP1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC42EP1
  
  

  Source: E. coli

  Amino Acid Sequence: GAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CDC42EP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17693.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDC42EP1 Recombinant Protein Antigen

• Binder of Rho GTPases 5
• Borg5
• BORG5cdc42 effector protein 1
• CDC42 effector protein (Rho GTPase binding) 1
• CEP155 kDa bone marrow stromal/endothelial cell protein
• MSE55MGC15316
• serum constituent protein
• Serum protein MSE55

Background

CDC42EP1, also known as CDC42 Effector Protein 1, consists of a 40.2 kDa and 39.7 kDa isoform, and is involved in regulatory processes within the cell as a member of the Rho GTPase family. Most commonly found in bone marrow, the CDC42EP1 proteins been shown to help facilitate actin cytoskeleton restructuring and cell shape regulation. The protein is being studied for its involvement in osteonecrosis. The protein has been linked to the RhoA and Rho GTPases pathways where it interacts with MAPKAP1, RPTOR, RHOQ, CDC42, RBPMS, KRTAP4-12, PLSCR1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CDC42EP1