CDC42EP1 Recombinant Protein Antigen

Images

 
There are currently no images for CDC42EP1 Recombinant Protein Antigen (NBP3-17693PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDC42EP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC42EP1

Source: E. coli

Amino Acid Sequence: GAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC42EP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17693.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDC42EP1 Recombinant Protein Antigen

  • Binder of Rho GTPases 5
  • Borg5
  • BORG5cdc42 effector protein 1
  • CDC42 effector protein (Rho GTPase binding) 1
  • CEP155 kDa bone marrow stromal/endothelial cell protein
  • MSE55MGC15316
  • serum constituent protein
  • Serum protein MSE55

Background

CDC42EP1, also known as CDC42 Effector Protein 1, consists of a 40.2 kDa and 39.7 kDa isoform, and is involved in regulatory processes within the cell as a member of the Rho GTPase family. Most commonly found in bone marrow, the CDC42EP1 proteins been shown to help facilitate actin cytoskeleton restructuring and cell shape regulation. The protein is being studied for its involvement in osteonecrosis. The protein has been linked to the RhoA and Rho GTPases pathways where it interacts with MAPKAP1, RPTOR, RHOQ, CDC42, RBPMS, KRTAP4-12, PLSCR1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88380
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-88382
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-88383
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91773
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
NBP3-15915
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-48546
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
MAB7662
Species: Hu
Applications: Flow, ICC, IHC, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-17693PEP
Species: Hu
Applications: AC

Publications for CDC42EP1 Recombinant Protein Antigen (NBP3-17693PEP) (0)

There are no publications for CDC42EP1 Recombinant Protein Antigen (NBP3-17693PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42EP1 Recombinant Protein Antigen (NBP3-17693PEP) (0)

There are no reviews for CDC42EP1 Recombinant Protein Antigen (NBP3-17693PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDC42EP1 Recombinant Protein Antigen (NBP3-17693PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC42EP1 Products

Research Areas for CDC42EP1 Recombinant Protein Antigen (NBP3-17693PEP)

Find related products by research area.

Blogs on CDC42EP1

There are no specific blogs for CDC42EP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDC42EP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42EP1