CDC2L6 Antibody (3D7)

Images

 
Immunohistochemistry-Paraffin: CDC2L6 Antibody (3D7) [H00023097-M01] - Analysis of monoclonal antibody to CDC2L6 on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.
Sandwich ELISA: CDC2L6 Antibody (3D7) [H00023097-M01] - Detection limit for recombinant GST tagged CDC2L6 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC, IHC-P, S-ELISA
Clone
3D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CDC2L6 Antibody (3D7) Summary

Immunogen
CDC2L6 (NP_055891.1, 1 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRAS
Specificity
CDC2L6 - cell division cycle 2-like 6 (CDK8-like) (3D7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDK19
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
This product is useful for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDC2L6 Antibody (3D7)

  • bA346C16.3
  • CDC2L6
  • CDC2-related protein kinase 6
  • CDK8-like cyclin-dependent kinase
  • cell division cycle 2-like 6 (CDK8-like)
  • Cell division cycle 2-like protein kinase 6
  • Cell division protein kinase 19
  • cyclin-dependent kinase (CDC2-like) 11
  • Cyclin-dependent kinase 11
  • cyclin-dependent kinase 19
  • Death-preventing kinase
  • EC 2.7.11
  • EC 2.7.11.22
  • KIAA1028CDK11

Background

This gene encodes a protein that is one of the components of the Mediator coactivator complex. The Mediator complex is a multiprotein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-496
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-92609
Species: Hu, Mu
Applications: WB, ICC/IF
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-16195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92044
Species: Hu, Mu
Applications: WB
NBP2-75607
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-73636
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, CyTOF-ready
NBP1-87132
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48308
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-89699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
MAB6570
Species: Hu
Applications: WB, IHC
NBP1-92392
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP3-04662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP

Publications for CDC2L6 Antibody (H00023097-M01) (0)

There are no publications for CDC2L6 Antibody (H00023097-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC2L6 Antibody (H00023097-M01) (0)

There are no reviews for CDC2L6 Antibody (H00023097-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDC2L6 Antibody (H00023097-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CDC2L6 Products

Bioinformatics Tool for CDC2L6 Antibody (H00023097-M01)

Discover related pathways, diseases and genes to CDC2L6 Antibody (H00023097-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC2L6 Antibody (H00023097-M01)

Discover more about diseases related to CDC2L6 Antibody (H00023097-M01).
 

Pathways for CDC2L6 Antibody (H00023097-M01)

View related products by pathway.

Research Areas for CDC2L6 Antibody (H00023097-M01)

Find related products by research area.

Blogs on CDC2L6

There are no specific blogs for CDC2L6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC2L6 Antibody (3D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK19
Entrez
Uniprot