Home » CDC2L6 » CDC2L6 Antibodies » CDC2L6 Antibody (3D7)

CDC2L6 Antibody (3D7)

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: CDC2L6 Antibody (3D7) [H00023097-M01] - Analysis of monoclonal antibody to CDC2L6 on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.
Immunohistochemistry-Paraffin: CDC2L6 Antibody (3D7) [H00023097-M01] - Analysis of monoclonal antibody to CDC2L6 on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.
Sandwich ELISA: CDC2L6 Antibody (3D7) [H00023097-M01] - Detection limit for recombinant GST tagged CDC2L6 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC, IHC-P, S-ELISA
Clone
3D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CDC2L6 Antibody (3D7) Summary

Immunogen
CDC2L6 (NP_055891.1, 1 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRAS
Specificity
CDC2L6 - cell division cycle 2-like 6 (CDK8-like) (3D7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDK19
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
This product is useful for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDC2L6 Antibody (3D7)

  • bA346C16.3
  • CDC2L6
  • CDC2-related protein kinase 6
  • CDK8-like cyclin-dependent kinase
  • cell division cycle 2-like 6 (CDK8-like)
  • Cell division cycle 2-like protein kinase 6
  • Cell division protein kinase 19
  • cyclin-dependent kinase (CDC2-like) 11
  • Cyclin-dependent kinase 11
  • cyclin-dependent kinase 19
  • Death-preventing kinase
  • EC 2.7.11
  • EC 2.7.11.22
  • KIAA1028CDK11

Background

This gene encodes a protein that is one of the components of the Mediator coactivator complex. The Mediator complex is a multiprotein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDC2L2 Antibody
NB100-496
Western Blot: CDC2L2 Antibody [NB100-496] - Whole cell lysate (15 ug) from HeLa and HEK293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-CDK11 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: CDC2L2 Antibody [NB100-496] - Section of human lung carcinoma. Antibody: Affinity purified rabbit anti-CDK11 (NB100-496). Detection: DAB
Immunoprecipitation: CDC2L2 Antibody [NB100-496] - Detection of human CDK11 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-CDK11 antibody NB100-496 (lot NB100-496-3) used for IP at 3 ug per reaction. CDK11 was also immunoprecipitated by a previous lot of this antibody (lot NB100-496-2). For blotting immunoprecipitated CDK11, NB100-496 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Species: Hu
Applications: WB, IHC, IHC-P, IP
CDC2L1 Antibody
NBP2-92609
Western Blot: CDC2L1 Antibody [NBP2-92609] - Analysis of extracts of various cell lines, using CDC2L1 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: CDC2L1 Antibody [NBP2-92609] - Analysis of HeLa cells using CDC2L1 at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu
Applications: WB, ICC/IF
KIR2DL3/CD158b2
Antibody (180701) [Un ...
MAB2014
Human peripheral blood mononuclear cells (PBMCs) were stained with (A) Mouse Anti-Human KIR2DL3/CD158b2 Monoclonal Antibody (Catalog # MAB2014) or (B) Isotype Control Antibody (Catalog # MAB003) followed by anti-Mouse IgG APC-conjugated secondary antibody (Catalog # F0101B) and Mouse Anti-Human NCAM‑1/CD56 PE‑conjugated Monoclonal Antibody (Catalog # FAB2408P).View our protocol for Staining Membrane-associated Proteins.
(1 Review)
(8 Publications)
Species: Hu
Applications: Flow, CyTOF-reported
DNAJC3 Antibody
NBP2-16195
Western Blot: DNAJC3 Antibody [NBP2-16195] - Sample (30 ug of whole cell lysate) A: Raji 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: DNAJC3 Antibody [NBP2-16195] - A431 cells were fixed in iced-cold MeOH for 5 min. Green: DNAJC3 protein stained by DNAJC3 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: DNAJC3 Antibody [NBP2-16195] - Immunohistochemical analysis of paraffin-embedded Colon ca, using antibody at 1:250 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DNA Primase large
subunit Antibody
NBP2-92044
Western Blot: DNA Primase large subunit Antibody [NBP2-92044] - Analysis of extracts of mouse spleen, using DNA Primase large subunit at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.
Western Blot: DNA Primase large subunit Antibody [NBP2-92044] - Analysis of extracts of various cell lines, using DNA Primase large subunit at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Species: Hu, Mu
Applications: WB
PAK2 Antibody
(JB41-84)
NBP2-75607
Western Blot: PAK2 Antibody (JB41-84) [NBP2-75607] - Analysis of PAK2 on mouse thymus tissue (1) and MCF-7 cell (2) lysate using anti-PAK2 antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: PAK2 Antibody (JB41-84) [NBP2-75607] - Staining PAK2 in SiHa cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PAK2 Antibody (JB41-84) [NBP2-75607] - Analysis of paraffin-embedded rat kidney tissue using anti-PAK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Proteasome 19S S3
Antibody (OTI2A2) - A ...
NBP2-73636
Western Blot: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Proteasome 19S S3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Prot
Flow Cytometry: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostaining by anti-Proteasome 19S S3 antibody, and then analyzed by flow cytometry.
Western Blot: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Proteasome 19S S3 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, CyTOF-ready
IFIT5 Antibody
NBP1-87132
Western Blot: IFIT5 Antibody [NBP1-87132] - Analysis in control (vector only transfected HEK293T lysate) and IFIT5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: IFIT5 Antibody [NBP1-87132] - Staining of human lateral ventricle shows strong cytoplasmic positivity in astrocytes.
Species: Hu
Applications: WB, IHC, IHC-P
PKM2 Antibody
NBP1-48308
Western Blot: PKM2 Antibody [NBP1-48308] - Expression of PKM1 and PKM2 in clinical colorectal cancer samples. The protein expression of PKM1 and PKM2 in clinical specimens of cancer tumor (T) and the adjacent normal tissues (N) is shown. PKM1 and PKM2 were detected by Western blotting in under the same experimental conditions at the same time. The full-length blots are presented in Supplementary Figure S3b. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep08647) licensed under a CC-BY licence.
Western Blot: PKM2 Antibody [NBP1-48308] - Expression profile of PKM isoforms in tissues from mouse organs. PKM1 and PKM2 were detected by Western blotting in under the same experimental conditions at the same time. The full-length blots are presented in Supplementary Figure S2b. Results are presented as the mean +/- SD (** P < 0.01). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep08647) licensed under a CC-BY licence.
Simple Western: PKM2 Antibody [NBP1-48308] - Lane view shows a specific band for PKM2 in 0.1 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(3 Reviews)
(14 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD
hHR23b Antibody
NBP1-89699
Western Blot: hHR23b Antibody [NBP1-89699] - Analysis in human cell line RH-30.
Immunocytochemistry/Immunofluorescence: hHR23b Antibody [NBP1-89699] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89699] - Staining of human testis.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ERp57/PDIA3
Antibody
NBP1-84796
Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis using Anti-PDIA3 antibody NBP1-84796 (A) shows similar pattern to independent antibody NBP1-84797 (B).
Immunocytochemistry/Immunofluorescence: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining in human thyroid gland and skeletal muscle tissues using NBP1-84796 antibody. Corresponding PDIA3 RNA-seq data are presented for the same tissues.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
SART3 Antibody
NB100-74648
Western Blot: SART3 Antibody [NB100-74648] - Detection of Human SART3/TIP110 on HeLa whole cell lysate using NB100-74648. SART3 was also immunoprecipitated by rabbit anti-SART3 antibody NB100-74649.
Immunocytochemistry/Immunofluorescence: SART3 Antibody [NB100-74648] - FFPE section of human pancreatic islet cell tumor. Affinity purified rabbit anti-SART3 used at a dilution of 1:100. Detection: Red fluorescent goat anti-rabbit IgG highly cross-adsorbed Antibody Hilyte PlusTM 555 used at a dilution of 1:100.
Immunohistochemistry: SART3 Antibody [NB100-74648] - Sample: FFPE sections of human ovarian carcinoma (left) and colon carcinoma (right). Antibody: Affinity purified rabbit anti- SART3/TIP110 used at a dilution of 1:200 (1ug/ml) and 1:400 (0.5 ug/ml). Detection: DAB and Red-fluorescent Goat anti-Rabbit IgG
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
CDP/CUTL1 Antibody
NBP2-13883
Western Blot: CDP/CUTL1 Antibody [NBP2-13883] - Analysis in human thyroid gland tissue.
Immunocytochemistry/Immunofluorescence: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human cell line MCF7 shows localization to nucleoplasm and the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human liver shows no positivity in hepatocytes as expected.
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
Cyclin D3 Antibody
(588726)
MAB6570
Western blot shows lysates of BaF3 mouse pro-B cell line, Jurkat human acute T cell leukemia cell line, and K562 human chronic myelogenous leukemia cell line. PVDF Membrane was probed with 1 µg/mL of Human Cyclin D3 Monoclonal Antibody (Catalog # MAB6570) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Cyclin D3 at approximately 37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Cyclin D3 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Human Cyclin D3 Monoclonal Antibody (Catalog # MAB6570) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu
Applications: WB, IHC
SKAR Antibody
NBP1-92392
Western Blot: SKAR Antibody [NBP1-92392] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: SKAR Antibody [NBP1-92392] - Staining of human cell line A-431 shows localization to nuclear speckles & cytoplasmic bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SKAR Antibody [NBP1-92392] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CDK8 Antibody (5H4)
H00001024-M03
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in K-562 (Cat # L009V1).
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in PC-12 (Cat # L012V1).
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in Hela S3 NE (Cat # L013V3).
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Western Blot: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
FLJ11506 Antibody
NBP1-87905
Western Blot: FLJ11506 Antibody [NBP1-87905] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: FLJ11506 Antibody [NBP1-87905] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FLJ11506 Antibody [NBP1-87905] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.
(3 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Western blot of PCNA levels across different stages of the cell cycle. U-2 OS cells were synchronised at G1/S with 2 mM thymidine an released for 10 hours for G2/M or re-arrested in G2 for extended duration with 10uM RO-3306. Antibody at 1:2000. WB image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - Development of the germinal zones in the tree shrew neocortex. Immunofluorescence for PCNA (yellow) and DAPI staining (blue) on 30 um-cryosections of E32-P1 tree shrew neocortex. The top margin of the image corresponds to the transition zone SVZ/intermediate zone. Scale bars, 50 um. VZ, ventricular zone; SVZ, subventricular zone; iSVZ, inner SVZ; oSVZ, outer SVZ. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fnana.2018.00029/full), licensed under a CC-BY licence.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(5 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
GTF2H3 Antibody
NBP3-04662
Western Blot: GTF2H3 Antibody [NBP3-04662] - Analysis of 200ug extracts of HT-29 cells using GTF2H3 antibody. Western blot was performed from the immunoprecipitate using this antibody
Immunocytochemistry/Immunofluorescence: GTF2H3 Antibody [NBP3-04662] - Analysis of A549 cells using GTF2H3 antibody. Blue: DAPI for nuclear staining.
Western Blot: GTF2H3 Antibody [NBP3-04662] - Analysis of extracts of various cell lines, using GTF2H3 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP

Publications for CDC2L6 Antibody (H00023097-M01) (0)

There are no publications for CDC2L6 Antibody (H00023097-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC2L6 Antibody (H00023097-M01) (0)

There are no reviews for CDC2L6 Antibody (H00023097-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDC2L6 Antibody (H00023097-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CDC2L6 Products

Bioinformatics Tool for CDC2L6 Antibody (H00023097-M01)

Discover related pathways, diseases and genes to CDC2L6 Antibody (H00023097-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC2L6 Antibody (H00023097-M01)

Discover more about diseases related to CDC2L6 Antibody (H00023097-M01).
 

Pathways for CDC2L6 Antibody (H00023097-M01)

View related products by pathway.

Research Areas for CDC2L6 Antibody (H00023097-M01)

Find related products by research area.

Blogs on CDC2L6

There are no specific blogs for CDC2L6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC2L6 Antibody (3D7) and receive a gift card or discount.


Bioinformatics

Gene Symbol CDK19
Entrez
Uniprot