CD39L2/ENTPD6 Antibody (2D10)

Images

 
Immunohistochemistry-Paraffin: CD39L2/ENTPD6 Antibody (2D10) [H00000955-M03] - Analysis of monoclonal antibody to ENTPD6 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CD39L2/ENTPD6 Antibody (2D10) Summary

Immunogen
ENTPD6 (NP_001238 386 a.a. - 484 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS
Specificity
ENTPD6 (2D10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ENTPD6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD39L2/ENTPD6 Antibody (2D10)

  • CD39 antigen-like 2
  • CD39L2
  • CD39L2NTPDase-6
  • CD39-like 2
  • dJ738P15.3
  • DKFZp781G2277
  • DKFZp781K21102
  • EC 3.6.1.6
  • ectonucleoside triphosphate diphosphohydrolase 6 (putative function)
  • ectonucleoside triphosphate diphosphohydrolase 6 (putative)
  • ectonucleoside triphosphate diphosphohydrolase 6
  • ENTPD6
  • FLJ36711
  • IL-6SAG
  • IL6ST2
  • interleukin 6 signal transducer-2
  • NTPD3
  • NTPDase 6

Background

ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which is characteristic of NTPases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85751
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4400
Species: Hu
Applications: WB, IHC
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90071
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85752
Species: Hu
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-42805
Species: Hu, Mu, Rt, Po, Bv, Xp, Dr(-)
Applications: WB
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-47446
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for CD39L2/ENTPD6 Antibody (H00000955-M03) (0)

There are no publications for CD39L2/ENTPD6 Antibody (H00000955-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD39L2/ENTPD6 Antibody (H00000955-M03) (0)

There are no reviews for CD39L2/ENTPD6 Antibody (H00000955-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD39L2/ENTPD6 Antibody (H00000955-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD39L2/ENTPD6 Products

Bioinformatics Tool for CD39L2/ENTPD6 Antibody (H00000955-M03)

Discover related pathways, diseases and genes to CD39L2/ENTPD6 Antibody (H00000955-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD39L2/ENTPD6 Antibody (H00000955-M03)

Discover more about diseases related to CD39L2/ENTPD6 Antibody (H00000955-M03).
 

Pathways for CD39L2/ENTPD6 Antibody (H00000955-M03)

View related products by pathway.

Research Areas for CD39L2/ENTPD6 Antibody (H00000955-M03)

Find related products by research area.

Blogs on CD39L2/ENTPD6

There are no specific blogs for CD39L2/ENTPD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD39L2/ENTPD6 Antibody (2D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol ENTPD6
Entrez
OMIM
Uniprot