CD3 gamma Antibody (2A6) - Azide and BSA Free

• Reactivity: Hu
• Applications: ELISA
• Clone: 2A6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CD3 gamma Antibody (2A6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CD3G (NP_000064, 23 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN
• Specificity: CD3G - CD3G antigen, gamma polypeptide (TiT3 complex)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CD3G
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD3 gamma Antibody (2A6) - Azide and BSA Free

• CD3 gamma
• CD3g antigen
• CD3g antigen, gamma polypeptide (TiT3 complex)
• CD3g molecule, epsilon (CD3-TCR complex)
• CD3g molecule, gamma (CD3-TCR complex)
• CD3g
• CD3-GAMMA
• FLJ17620
• FLJ17664
• FLJ79544
• FLJ94613
• IMD17
• MGC138597
• T3G
• T-cell antigen receptor complex, gamma subunit of T3
• T-cell receptor T3 gamma chain
• T-cell surface glycoprotein CD3 gamma chain

Background

The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency. [provided by RefSeq]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD3G
• Entrez:
  • 917(Human)
• OMIM:
  • 186740(Human)
• Uniprot:
  • NP_000064()