CD2BP2 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD2BP2 Antibody [NBP2-47516] - Staining in human fallopian tube and skeletal muscle tissues using anti-CD2BP2 antibody. Corresponding CD2BP2 RNA-seq data are presented for the same tissues.

Western Blot: CD2BP2 Antibody [NBP2-47516] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line MCF-7

Immunocytochemistry/Immunofluorescence: CD2BP2 Antibody [NBP2-47516] - Staining of human cell line U-251 MG shows localization to nuclear speckles and cytosol.

Immunohistochemistry-Paraffin: CD2BP2 Antibody [NBP2-47516] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: CD2BP2 Antibody [NBP2-47516] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD2BP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LGPHNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLY
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD2BP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CD2BP2 Protein (NBP2-47516PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD2BP2 Antibody - BSA Free

• CD2 (cytoplasmic tail) binding protein 2
• CD2 antigen (cytoplasmic tail) binding protein 2
• CD2 antigen (cytoplasmic tail)-binding protein 2
• CD2 antigen cytoplasmic tail-binding protein 2
• CD2 binding protein 2
• CD2 cytoplasmic domain binding protein 2
• CD2 cytoplasmic domain-binding protein 2
• CD2 tail-binding protein 2
• FWP010
• KIAA1178
• LIN1
• Snu40
• U5 snRNP 52K protein
• U5-52K

Background

CD2BP2 is an intracellular protein which binds to a site containing two PPPGHR segments within the cytoplasmic region of CD2. Mutagenesis and NMR analysis demonstrated that the CD2 binding region of CD2BP2 includes a 17 amino acid motif also found in several yeast and Caenorhabditis elegans proteins of unknown function. In Jurkat T cells, over expression of the isolated CD2BP2 domain binding to CD2 enhances the production of interleukin 2 on crosslinking of CD2 but not the T cell receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD2BP2