CD23/Fc epsilon RII Recombinant Protein Antigen

Images

 
There are currently no images for CD23/Fc epsilon RII Recombinant Protein Antigen (NBP3-16985PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD23/Fc epsilon RII Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD23/Fc epsilon RII

Source: E. coli

Amino Acid Sequence: LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FCER2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-16985.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD23/Fc epsilon RII Recombinant Protein Antigen

  • BLAST-2
  • CD23
  • CD23A
  • CD23CD23 antigen
  • CLEC4J
  • CLEC4JC-type lectin domain family 4 member J
  • C-type lectin domain family 4, member J
  • Fc epsilon RII
  • Fc fragment of IgE, low affinity II, receptor for (CD23)
  • FCE2Fc fragment of IgE, low affinity II, receptor for (CD23A)
  • fc-epsilon-RII
  • FCER2
  • Fcer2a
  • FceRII
  • IGEBF
  • Immunoglobulin E-binding factor
  • low affinity immunoglobulin epsilon Fc receptor
  • Ly-42
  • Lymphocyte IgE receptor

Background

The CD23 antigen is the low affinity IgE Fc receptor, which is a 49 kDa protein with 38 and 28 kDa fragments. It is expressed on most mature, conventional B cells (but not on peritoneal CD5+ B cells), and can also be found on the surface of T cells, macrophages, platelets and EBV transformed B lymphoblasts. Expression of CD23 has been detected in neoplastic cells from cases of B cell chronic Lymphocytic leukemia. CD23 is expressed by B cells in the follicular mantle but not by proliferating germinal centre cells. CD23 is also expressed by eosinophils. CD23 is distinct from the high affinity IgE receptors found on basophils and mast cells, which mediate allergic reactions. The low affinity receptors are thought to play a role in isotype specific immunoregulation. The regulation of CD23 surface expression appears to be integral with the complex IgE system, which involves interactions of cells, cytokines, antibodies and regulatory factors. CD23 has been described as a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

6507-IL/CF
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-70360
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC,  IHC-P, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, ISH, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
202-IL
Species: Hu
Applications: BA
DR2A00
Species: Hu
Applications: ELISA
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
H00003669-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
NBP2-25265
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
485-MI
Species: Mu
Applications: BA
NBP3-16985PEP
Species: Hu
Applications: AC

Publications for CD23/Fc epsilon RII Recombinant Protein Antigen (NBP3-16985PEP) (0)

There are no publications for CD23/Fc epsilon RII Recombinant Protein Antigen (NBP3-16985PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD23/Fc epsilon RII Recombinant Protein Antigen (NBP3-16985PEP) (0)

There are no reviews for CD23/Fc epsilon RII Recombinant Protein Antigen (NBP3-16985PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD23/Fc epsilon RII Recombinant Protein Antigen (NBP3-16985PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD23/Fc epsilon RII Products

Research Areas for CD23/Fc epsilon RII Recombinant Protein Antigen (NBP3-16985PEP)

Find related products by research area.

Blogs on CD23/Fc epsilon RII

There are no specific blogs for CD23/Fc epsilon RII, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD23/Fc epsilon RII Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FCER2