CD229/SLAMF3/Lymphocyte Antigen 9 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LY9. Source: E. coli
Amino Acid Sequence: KRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
LY9 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30776. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for CD229/SLAMF3/Lymphocyte Antigen 9 Recombinant Protein Antigen
Background
LY9, also known as T-lymphocyte surface Antigen Ly-9, consists of four isoforms of sizes 72.1 kDa, 70.7 kDa, 57.3 kDa, and 72 kDa and interacts with adaptor molecules as an immunomodulatory receptor and member of the SLAM family. Current research is being conducted to identify the effect of the protein on diseases and disorders such as myeloma, hepatitis, lymphoproliferative syndrome, and dysgammaglobulinemia. The protein is involved in cell adhesion pathways with SH2D1A, AP2M1, PTPN11, GRB2, and SH2D1B proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Mu
Applications: ELISA
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, WB
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Publications for CD229/SLAMF3/Lymphocyte Antigen 9 Protein (NBP2-30776PEP) (0)
There are no publications for CD229/SLAMF3/Lymphocyte Antigen 9 Protein (NBP2-30776PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD229/SLAMF3/Lymphocyte Antigen 9 Protein (NBP2-30776PEP) (0)
There are no reviews for CD229/SLAMF3/Lymphocyte Antigen 9 Protein (NBP2-30776PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for CD229/SLAMF3/Lymphocyte Antigen 9 Protein (NBP2-30776PEP) (0)
Additional CD229/SLAMF3/Lymphocyte Antigen 9 Products
Research Areas for CD229/SLAMF3/Lymphocyte Antigen 9 Protein (NBP2-30776PEP)
Find related products by research area.
|
Blogs on CD229/SLAMF3/Lymphocyte Antigen 9