CD1e Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CD1e Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD1e
  
  

  Source: E.coli

  Amino Acid Sequence: ISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CD1E
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24723It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD1e Recombinant Protein Antigen

• CD1-alpha-3
• CD1e molecule
• CD1e
• CDIEL
• e polypeptide
• FLJ17609
• membrane-associated
• R2G1
• thymocyte antigen CD1E

Background

The CD1E gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to themajor histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteinsmediate the presentation of

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD1E