CCT6B Antibody - Azide and BSA Free

Western Blot: CCT6B Antibody [NBP2-92177] - Analysis of extracts of various cell lines, using CCT6B at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 15s.

Immunocytochemistry/Immunofluorescence: CCT6B Antibody [NBP2-92177] - Analysis of L929 cells using CCT6B at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: CCT6B Antibody [NBP2-92177] - Analysis of HeLa cells using CCT6B at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CCT6B Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit CCT6B Antibody - Azide and BSA Free (NBP2-92177) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-CCT6B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-340 of human CCT6B (NP_006575.2). AEGFEAAKIKALEVLEEVKVTKEMKRKILLDVARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKLGTDTKLIQGLVLDHGARHPDMKKRVEDAFILICNVSLEYEKTEVNSGFFYKTAEEKEKLVKAERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPFSLDSLAKHGIVALRRAKRRNMERLSLACGGMAVNSFEDLT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCT6B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 58 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for CCT6B Antibody - Azide and BSA Free

• Cctz2
• CCTZ-2
• CCT-zeta-2
• CCT-zeta-like
• chaperonin containing TCP1, subunit 6B (zeta 2)
• T-complex protein 1 subunit zeta-2
• T-complex protein 1, zeta-2 subunit
• TCP-1-zeta-2
• TCP-1-zeta-like
• Testis-specific protein TSA303
• Testis-specific Tcp20
• TSA303

Background

CCT6B encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for CCT6B Antibody (NBP2-92177)(1)

Publication using NBP2-92177

• Yang P, Tang W, Li H et al. T-complex protein 1 subunit zeta-2 (CCT6B) deficiency induces murine teratospermia PeerJ Jun 1 2021 [PMID: 34141486] (Mouse)

Bioinformatics

• Gene Symbol: CCT6B