CCT6A Antibody

Images

 
Western Blot: CCT6A Antibody [NBP2-33583] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CCT6A Antibody [NBP2-33583] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CCT6A Antibody [NBP2-33583] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCT6A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAK
Specificity
Specificity of human CCT6A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCT6A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCT6A Recombinant Protein Antigen (NBP2-33583PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCT6A Antibody

  • acute morphine dependence related protein 2
  • Acute morphine dependence-related protein 2
  • amino acid transport defect-complementing
  • CCT6
  • Cctz
  • CCT-zeta
  • CCT-zeta-1
  • chaperonin containing T-complex subunit 6
  • chaperonin containing TCP1, subunit 6A (zeta 1)
  • histidine transport regulator 3
  • HTR3MGC126215
  • MGC126214
  • MoDP-2
  • T-complex protein 1 subunit zeta
  • T-complex protein 1, zeta subunit
  • TCP-1-zeta
  • TCP20
  • TCPZ
  • TTCP20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97505
Species: Hu, Mu, Rt, Po, Bv, Ce, Ca, Dr, GP, Pl, Pm, Rb, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP1-88146
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56351
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-74633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-55460
Species: Hu
Applications: WB, ICC/IF
H00022948-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88145
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61787
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00009468-D01P
Species: Hu
Applications: WB, ELISA
H00010693-M01
Species: Hu
Applications: WB, ELISA
NBP1-84366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88144
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33583
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CCT6A Antibody (NBP2-33583) (0)

There are no publications for CCT6A Antibody (NBP2-33583).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCT6A Antibody (NBP2-33583) (0)

There are no reviews for CCT6A Antibody (NBP2-33583). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCT6A Antibody (NBP2-33583) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CCT6A Antibody (NBP2-33583)

Discover related pathways, diseases and genes to CCT6A Antibody (NBP2-33583). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCT6A Antibody (NBP2-33583)

Discover more about diseases related to CCT6A Antibody (NBP2-33583).
 

Pathways for CCT6A Antibody (NBP2-33583)

View related products by pathway.

PTMs for CCT6A Antibody (NBP2-33583)

Learn more about PTMs related to CCT6A Antibody (NBP2-33583).

Blogs on CCT6A

There are no specific blogs for CCT6A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCT6A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCT6A