Home » CCDC85A » CCDC85A Proteins » CCDC85A Recombinant Protein Antigen

CCDC85A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CCDC85A Protein (NBP1-93565PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

CCDC85A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCDC85A.

Source: E.coli

Amino Acid Sequence: RHPHPGSSPETLPKHVLSGSPEHFQKHRSGSSPEHARHSGGSPEHLQKHALGGSLEHLPRARGTSPEHLKQHYGGSPDHKHGGGSGGS
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCDC85A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-93565.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CCDC85A Recombinant Protein Antigen

  • coiled-coil domain containing 85A
  • coiled-coil domain-containing protein 85A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ASB3 Antibody
NB100-56645
Western Blot: ASB3 Antibody [NB100-56645] - Western blot analysis of ASB3 in 15 ugs of human spleen cell lysate using NB100-56645 at 1:1000 dilution.
Species: Hu, Mu(-), Rt(-)
Applications: WB
Dexras1 Antibody
NBP1-91830
Western Blot: Dexras1 Antibody [NBP1-91830] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Dexras1 Antibody [NBP1-91830] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human urinary bladder shows moderate cytoplasmic and nuclear positivity in urothelial cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CaMKII beta
Antibody
NB120-22131
Western Blot: CaMKII beta Antibody [NB120-22131] - Analysis of CAMKIIb in rat brain lysate using NB120-22131 at 1:2000.
Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NB120-22131] - Staining of CAMKIIb using NB120-22131 in rat hippocampal neurons at a dilution of 1:100, note that staining is rather weak.
Western Blot: CaMKII beta Antibody [NB120-22131] - Analysis of CAMKII beta in A) human, B) mouse and C) rat brain lysate using CAMKII beta antibody at 1:2000.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Ikaros/IKZF1
Antibody [Unconjugate
AF4984
Western blot shows lysates of Nalm‑6 human Pre‑B acute lymphocytic leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Bands were detected for Ikaros (1-8 spice forms) at approximately 37 to 63 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Jurkat human acute T cell leukemia cell line treated with 50 ng/mL PMA and 200 ng/mL calcium ionomycin for 30 minutes was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Ikaros/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The VPAC promoter was detected by standard PCR.
Simple Western lane view shows lysates of Nalm‑6 human Pre-B acute lymphocytic leukemia cell line, loaded at 0.2 mg/mL. Specific bands were detected for Ikaros at approximately 63-77 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NBR1 Antibody
NBP1-71703
Western Blot: NBR1 Antibody [NBP1-71703] - The antibody could detect Hela cell NBR1,a band about 130KDa. It detects a 100KDa band in mouse brain. This image was submitted via customer Review.
Immunocytochemistry/Immunofluorescence: NBR1 Antibody [NBP1-71703] - NBR1 antibody was tested at 1:50 in HeLa cells with FITC (green). Nuclei and actin were counterstained with Dapi (blue) and Phalloidin (red).
Immunohistochemistry: NBR1 Antibody [NBP1-71703] - Staining of NBRI in mouse prostate.
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
delta-Sarcoglycan
Antibody (3G10)
H00006444-M01-100ug
Western Blot: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Western Blot detection against Immunogen (34.1 KDa).
Immunocytochemistry/Immunofluorescence: delta Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Mouse Skeletal Muscle stained by verified customer.
ELISA: delta-Sarcoglycan Antibody (3G10) [H00006444-M01-100ug] - Detection limit for recombinant GST tagged SGCD is 0.03 ng/ml as a capture antibody.
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Serpin F1/PEDF
Antibody [Unconjugate
AF1177
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, human liver tissue, and human breast tissue. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Human/Mouse Serpin F1/PEDF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1177) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Serpin F1/PEDF at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Serpin F1/PEDF was detected in immersion fixed paraffin-embedded sections of human kidney using Goat Anti-Human/Mouse Serpin F1/PEDF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1177) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to convoluted tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Serpin F1/PEDF at approximately 56 kDa (as indicated) using 2 µg/mL of Goat Anti-Human/Mouse Serpin F1/PEDF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1177) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(7 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, IHC
MKK3/MEK3 Antibody
(2E12D11)
NBP2-52508
Western Blot: MKK3/MEK3 Antibody (2E12D11) [NBP2-52508] - Analysis using MAP2K3 mAb against human MAP2K3 (AA: 1-138) recombinant protein. (Expected MW is 42.1 kDa)
Immunohistochemistry: MKK3/MEK3 Antibody (2E12D11) [NBP2-52508] - Analysis of paraffin-embedded rectum cancer tissues using MAP2K3 mouse mAb with DAB staining.
Flow Cytometry: MKK3/MEK3 Antibody (2E12D11) [NBP2-52508] - Analysis of Hela cells using MAP2K3 mouse mAb (green) and negative control (red).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Neurofibromin 1
Antibody
NB300-155
Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).
Immunohistochemistry: Neurofibromin 1 Antibody [NB300-155] - NF1 protein labeling displays positive signal in the maturing and the hypertrophic cartilages but only faint labeling in the proliferative cartilage.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MOX1 Antibody
NBP1-76302
Western Blot: MOX1 Antibody [NBP1-76302] - Human liver tissue lysate with MOX1 antibody at (A) 1 and (B) 2 ug/mL.
Immunocytochemistry/Immunofluorescence: MOX1 Antibody [NBP1-76302] - Immunofluorescence of MOX1 in rat liver tissue with MOX1 antibody at 20 ug/mL.
Immunohistochemistry: MOX1 Antibody [NBP1-76302] - Immunohistochemistry of MOX1 in rat liver tissue with MOX1 antibody at 10 ug/mL.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
RASL10B Antibody
NBP2-13205
Immunohistochemistry-Paraffin: RASL10B Antibody [NBP2-13205] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: RASL10B Antibody [NBP2-13205] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: RASL10B Antibody [NBP2-13205] - Staining in human skeletal muscle and tonsil tissues using anti-RASL10B antibody. Corresponding RASL10B RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Neurexophilin-3
Antibody
AF5098
Western blot shows lysates of human brain (cerebellum) tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat Neurexophilin‑3/NXPH‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5098) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Neurexophilin‑3/NXPH‑3 at approximately XXX kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group XXX.
Species: Hu, Mu, Rt
Applications: WB
IGFBP-4 Antibody
NBP1-80549
Western Blot: IGFBP-4 Antibody [NBP1-80549] - Human Fetal Brain Lysate, concentration 1 ug/ml.
Immunocytochemistry/Immunofluorescence: IGFBP-4 Antibody [NBP1-80549] - Mouse uterus stained with at a dilution of 1:1000. HIER is applied using citrate buffer pH6. Image from verified customer review.
Immunohistochemistry-Paraffin: IGFBP-4 Antibody [NBP1-80549] - Human Prostate Tissue, 5.0ug/ml.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
HOXB5 Protein
H00003215-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
(2 Publications)
Species: Hu
Integrin alpha
3/CD49c Antibody
NBP2-48514
Western Blot: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Analysis in human cell lines U-251MG and HEK293 using anti-ITGA3 antibody. Corresponding ITGA3 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunohistochemistry-Paraffin: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Staining in human lung and skeletal muscle tissues. Corresponding ITGA3 RNA-seq data are presented for the same tissues.
Western Blot: Integrin alpha 3/CD49c Antibody [NBP2-48514] - Analysis in human cell line U-87 MG.
Species: Hu, Rt
Applications: WB, IHC, IHC-P
TRAP220/MED1
Antibody
AF5520
Western blot shows lysates of 293T human embryonic kidney cell line and HeLa human cervical epithelial carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse TRAP220 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5520) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for TRAP220 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 5.
(1 Review)
Species: Hu, Mu
Applications: WB
BAF57 Antibody
NBP1-90012
Western Blot: BAF57 Antibody [NBP1-90012] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: BAF57 Antibody [NBP1-90012] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: BAF57 Antibody [NBP1-90012] - Staining in human endometrium and liver tissues using anti-SMARCE1 antibody. Corresponding SMARCE1 RNA-seq data are presented for the same tissues.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PCYT1A Antibody
NBP1-84366
Western Blot: PCYT1A Antibody [NBP1-84366] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: PCYT1A Antibody [NBP1-84366] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PCYT1A Antibody [NBP1-84366] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
gamma Catenin
Antibody (JF0973)
NBP2-66858
Western Blot: gamma Catenin Antibody (JF0973) [NBP2-66858] - Analysis of gamma Catenin on Hela cells lysates using anti-gamma Catenin antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: gamma Catenin Antibody (JF0973) [NBP2-66858] - Staining gamma Catenin in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: gamma Catenin Antibody (JF0973) [NBP2-66858] - Analysis of paraffin-embedded mouse stomach tissue using anti-gamma Catenin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CCDC85A
Recombinant Protein A
NBP1-93565PEP
CCDC85A Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CCDC85A Protein (NBP1-93565PEP) (0)

There are no publications for CCDC85A Protein (NBP1-93565PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC85A Protein (NBP1-93565PEP) (0)

There are no reviews for CCDC85A Protein (NBP1-93565PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CCDC85A Protein (NBP1-93565PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array NBP1-93565PEP

Bioinformatics Tool for CCDC85A Protein (NBP1-93565PEP)

Discover related pathways, diseases and genes to CCDC85A Protein (NBP1-93565PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC85A Protein (NBP1-93565PEP)

Discover more about diseases related to CCDC85A Protein (NBP1-93565PEP).

Blogs on CCDC85A

There are no specific blogs for CCDC85A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CCDC85A Recombinant Protein Antigen
NBP2-49241PEP
Western Blot: NBR1 Antibody [NBP1-71703] - The antibody could detect Hela cell NBR1,a band about 130KDa. It detects a 100KDa band in mouse brain. This image was submitted via customer Review.
NBR1 Antibody
NBP1-71703
Immunocytochemistry/Immunofluorescence: CCDC85A Antibody [NBP1-93565] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
CCDC85A Antibody
NBP1-93565
Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).
Neurofibromin 1 Antibody
NB300-155

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CCDC85A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CCDC85A