CCDC68 Antibody - BSA Free

Western Blot: CCDC68 Antibody [NBP2-87151] - WB Suggested Anti-CCDC68 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Heart

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CCDC68 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CCDC68 Antibody - BSA Free (NBP2-87151) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of CCDC68. Peptide sequence: EAGAAALRNVAQRLFENYQTQSEEVRKKQEDSKQLLQVNKLEKEQKLKQH The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCDC68
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CCDC68 Antibody - BSA Free

• coiled-coil domain containing 68
• coiled-coil domain-containing protein 68
• CTCL tumor antigen se57-1
• CTCL-associated antigen se57-1
• cutaneous T-cell lymphoma associated antigen
• Cutaneous T-cell lymphoma-associated antigen se57-1
• FLJ25368
• SE57-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCDC68