CCDC59 Antibody - BSA Free

Western Blot: CCDC59 Antibody [NBP2-84615] - Host: Rabbit. Target Name: Ccdc59. Sample Type: Mouse Thymus lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CCDC59 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CCDC59 Antibody - BSA Free (NBP2-84615) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse CCDC59. Peptide sequence: KRAAKKFEFEMRKQEREEAQRLYKKKKMEAFKILSKKTKKGQPNLNLQME The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCDC59
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CCDC59 Antibody - BSA Free

• BR22HSPC128
• coiled-coil domain containing 59
• Coiled-coil domain-containing protein 59
• FLJ10294
• TAP26DKFZp686K1021
• thyroid transcription factor 1-associated protein 26
• TTF-1-associated protein 26
• TTF-1-associated protein BR2

Background

CCDC59 is a component of the transcription complexes of the pulmonary surfactant-associated protein-B (SFTPB) and -C (SFTPC). Enhances homeobox protein Nkx-2.1-activated SFTPB and SFTPC promoter activities

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCDC59