CCDC122 Antibody

Images

 
Western Blot: CCDC122 Antibody [NBP2-84598] - Host: Rabbit. Target Name: CCDC122. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC122 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC122. Peptide sequence: NKERKSQGFPKEDNQDTSSLADAVEKVAKQQQSQASEIEKNKKVLFNLKN The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC122
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC122 Antibody

  • Coiled-Coil Domain Containing 122

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7442
Species: Hu
Applications: B/N, WB
NBP1-92062
Species: Hu
Applications: IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB300-268
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
462-TR/CF
Species: Mu
Applications: BA
H00010910-M04
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NLS850
Species: Hu
Applications: IHC, IHC-P
NBP1-84602
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
MAB41681
Species: Hu
Applications: WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-80419
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC-P, WB
NBP2-46238
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-84598
Species: Hu
Applications: WB

Publications for CCDC122 Antibody (NBP2-84598) (0)

There are no publications for CCDC122 Antibody (NBP2-84598).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC122 Antibody (NBP2-84598) (0)

There are no reviews for CCDC122 Antibody (NBP2-84598). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC122 Antibody (NBP2-84598) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC122 Products

Bioinformatics Tool for CCDC122 Antibody (NBP2-84598)

Discover related pathways, diseases and genes to CCDC122 Antibody (NBP2-84598). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC122 Antibody (NBP2-84598)

Discover more about diseases related to CCDC122 Antibody (NBP2-84598).
 

Pathways for CCDC122 Antibody (NBP2-84598)

View related products by pathway.

Blogs on CCDC122

There are no specific blogs for CCDC122, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC122 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC122