CCDC109B Antibody


Immunohistochemistry-Paraffin: CCDC109B Antibody [NBP2-14657] - Staining of human tonsil shows high expression.
Immunohistochemistry-Paraffin: CCDC109B Antibody [NBP2-14657] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: CCDC109B Antibody [NBP2-14657] - Staining in human tonsil and kidney tissues using anti-MCUB antibody. Corresponding MCUB RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CCDC109B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLE QVKAGIEAHSE
Specificity of human CCDC109B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC109B Protein (NBP2-14657PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CCDC109B Antibody

  • CCDC109B coiled-coil domain containing 109B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC, IHC-P

Publications for CCDC109B Antibody (NBP2-14657) (0)

There are no publications for CCDC109B Antibody (NBP2-14657).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC109B Antibody (NBP2-14657) (0)

There are no reviews for CCDC109B Antibody (NBP2-14657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC109B Antibody (NBP2-14657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CCDC109B Products

CCDC109B NBP2-14657

Bioinformatics Tool for CCDC109B Antibody (NBP2-14657)

Discover related pathways, diseases and genes to CCDC109B Antibody (NBP2-14657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC109B Antibody (NBP2-14657)

Discover more about diseases related to CCDC109B Antibody (NBP2-14657).

Blogs on CCDC109B

There are no specific blogs for CCDC109B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCDC109B Antibody and receive a gift card or discount.


Gene Symbol CCDC109B