CCDC109B Antibody

Immunohistochemistry-Paraffin: CCDC109B Antibody [NBP2-14657] - Analysis in human lymph node and liver tissues using NBP2-14657 antibody. Corresponding MCUB RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CCDC109B Antibody [NBP2-14657] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: CCDC109B Antibody [NBP2-14657] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: CCDC109B Antibody [NBP2-14657] - Staining of human duodenum shows strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: CCDC109B Antibody [NBP2-14657] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CCDC109B Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCDC109B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CCDC109B Protein (NBP2-14657PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CCDC109B Antibody

• CCDC109B coiled-coil domain containing 109B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCDC109B