CCBE1 Antibody - BSA Free

Western Blot: CCBE1 Antibody [NBP1-79501] - Titration: 1.0 ug/ml Positive Control: Mouse Kidney.

Western Blot: CCBE1 Antibody [NBP1-79501] - Hsa_circ_0076931/miR-6760-3p/CCBE1 axis is predicted to play important roles in the progression of glioma(A) circRNA/miRNA/mRNA ceRNA network analysis. (B) The level of CCBE1 in H4 & U118-MG cells was detected by qRT-PCR after transfection with hsa_circ_0076931. (C) The level of CCBE1 in H4 & U118-MG cells was detected by Western blot after transfection with hsa_circ_0076931. (D) Quantification of CCBE1 protein is shown. (E) The level of miR-6067-3p in H4 & U118-MG cells was detected by qRT-PCR after transfection with hsa_circ_0076931. (F) Schematic of the binding site between hsa_circ_0076931 & miR-6067-3p, & the luciferase activity of WT hsa_circ_0076931 3′ UTR or mutant hsa_circ_0076931 3′ UTR after transfection with miR-6067-3p mimics in 293T cells. (G) Schematic of the binding site between miR-6067-3p & CCBE1. (H) AGO2-RIP assay was used to analyze the expression of hsa_circ_0076931, miR-6760-3p, & CCBE1 in U118-MG cells. (I) After interference with hsa_circ_0076931, the expression of CCBE1 was tested by AGO2-RIP assay in U118-MG cells; *P<0.05, **P<0.01, ***P<0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34931668), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CCBE1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human Ccbe1The immunogen for this antibody is Ccbe1. Peptide sequence RGAPGPPGSPGPPGSFDFLLLVLADIRNDIAELQEKVFGHRTHSSAEDFP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCBE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CCBE1 Antibody - BSA Free

• CCBE1
• collagen and calcium binding EGF domains 1
• collagen and calcium-binding EGF domain-containing protein 1
• Full of fluid protein homolog
• HKLLS1
• KIAA1983
• KIAA1983FLJ30681
• MGC50861

Background

CCBE1 is required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCBE1 Antibody (NBP1-79501)(1)

Publication using NBP1-79501

• Ke Y, Su S, Duan C et al. Hsa_circ_0076931 suppresses malignant biological properties, down-regulates miR-6760-3p through direct binding, and up-regulates CCBE1 in glioma Bioscience reports 2022-01-28 [PMID: 34931668] (WB, Human)

Bioinformatics

• Gene Symbol: CCBE1
• Uniprot:
  • NP_848908(Mouse)