CCAR1 Recombinant Protein Antigen

Images

 
There are currently no images for CCAR1 Recombinant Protein Antigen (NBP2-55611PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CCAR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCAR1.

Source: E. coli

Amino Acid Sequence: KEERDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDINRYCKERPSKDKEKEKTQMITINRDLLMAFVYFDQSHCGYLLE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCAR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55611.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CCAR1 Recombinant Protein Antigen

  • CARP-1
  • CARP1MGC44628
  • Cell cycle and apoptosis regulatory protein 1
  • cell division cycle and apoptosis regulator 1
  • cell division cycle and apoptosis regulator protein 1
  • Death inducer with SAP domain
  • DIS
  • FLJ10590
  • RP11-437A18.1

Background

Associates with components of the Mediator and p160 coactivator complexes that play a role as intermediaries transducing regulatory signals from upstream transcriptional activator proteins to basal transcription machinery at the core promoter. Recruited to endogenous nuclear receptor target genes in response to the appropriate hormone. Also functions as a p53 coactivator. May thus play an important role in transcriptional regulation . May be involved in apoptosis signaling in the presence of the reinoid CD437. Apoptosis induction involves sequestration of 14-3-3 protein(s) and mediated altered expression of multiple cell cycle regulatory genes including MYC, CCNB1 and CDKN1A. Plays a role in cell cycle progression and/or cell proliferation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84854
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP2-56413
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00009014-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-58841
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF
AF2187
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP2-15397
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-70411
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-47735
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-88376
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88640
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-83427
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-207
Species: Ce, Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP2-55611PEP
Species: Hu
Applications: AC

Publications for CCAR1 Recombinant Protein Antigen (NBP2-55611PEP) (0)

There are no publications for CCAR1 Recombinant Protein Antigen (NBP2-55611PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCAR1 Recombinant Protein Antigen (NBP2-55611PEP) (0)

There are no reviews for CCAR1 Recombinant Protein Antigen (NBP2-55611PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CCAR1 Recombinant Protein Antigen (NBP2-55611PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCAR1 Products

Array NBP2-55611PEP

Research Areas for CCAR1 Recombinant Protein Antigen (NBP2-55611PEP)

Find related products by research area.

Blogs on CCAR1

There are no specific blogs for CCAR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CCAR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CCAR1