CBX4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CBX4 Antibody [NBP2-55246] - Staining of human cell line U-2 OS shows localization to nuclear bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CBX4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDSGAEEK
Specificity
Specificity of human CBX4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBX4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CBX4 Recombinant Protein Antigen (NBP2-55246PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CBX4 Antibody

  • chromobox homolog 4 (Drosophila Pc class)
  • chromobox homolog 4
  • Chromobox protein homolog 4
  • Drosophila)
  • E3 SUMO-protein ligase CBX4
  • hPC2
  • NS5ATP1-binding protein 16
  • Pc class 2 homolog
  • PC2
  • Polycomb 2 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-27561
Species: Hu, Rt, Ch
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, B/N
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46587
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30117
Species: Hu, Mu
Applications: WB, IP
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP2-73621
Species: Hu
Applications: Flow, ICC/IF, CyTOF-ready
NBP1-52552
Species: Hu
Applications: IHC, IHC-P, IP, PEP-ELISA, IF

Publications for CBX4 Antibody (NBP2-55246) (0)

There are no publications for CBX4 Antibody (NBP2-55246).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBX4 Antibody (NBP2-55246) (0)

There are no reviews for CBX4 Antibody (NBP2-55246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CBX4 Antibody (NBP2-55246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CBX4 Products

Bioinformatics Tool for CBX4 Antibody (NBP2-55246)

Discover related pathways, diseases and genes to CBX4 Antibody (NBP2-55246). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBX4 Antibody (NBP2-55246)

Discover more about diseases related to CBX4 Antibody (NBP2-55246).
 

Pathways for CBX4 Antibody (NBP2-55246)

View related products by pathway.

PTMs for CBX4 Antibody (NBP2-55246)

Learn more about PTMs related to CBX4 Antibody (NBP2-55246).
 

Research Areas for CBX4 Antibody (NBP2-55246)

Find related products by research area.

Blogs on CBX4

There are no specific blogs for CBX4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBX4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBX4