Immunohistochemistry-Paraffin: CBX4 Antibody [NBP1-83225] - Staining of human bone marrow shows strong nuclear positivity in subset of hematopoietic cells.
Novus Biologicals Rabbit CBX4 Antibody - BSA Free (NBP1-83225) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CBX4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBX4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (85%).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for CBX4 Antibody - BSA Free
chromobox homolog 4 (Drosophila Pc class)
chromobox homolog 4
Chromobox protein homolog 4
Drosophila)
E3 SUMO-protein ligase CBX4
hPC2
NS5ATP1-binding protein 16
Pc class 2 homolog
PC2
Polycomb 2 homolog
Background
PC2 is the human homolog of the Drosophila 'Polycomb' (Pc) protein which has been identified as a gene family member associated with a cellular memory system that is responsible for the inheritance of gene activity by progeny cells. The human Pc homolog gene is more closely related to a Xenopus Pc homolog, XPc, than to a previously described human Pc homolog, CBX2 (hPc1). However, the hPc2 and CBX2/hPc1 proteins are shown to colocalize in interphase nuclei of human U-2 OS osteosarcoma cells, suggesting that the proteins are part of a common protein complex. The human protein is believed to function as a repressor of proto-oncogene activity and that interference with hPc2 function can lead to derepression of proto-oncogene transcription and subsequently to cellular transformation. Other reports describe PC2 as a protein that has SUMO E3 activity for the corepressors CtBP and CtBP2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for CBX4 Antibody (NBP1-83225). (Showing 1 - 2 of 2 FAQs).
I learn from your company web that you are providing atf6, xbp1, cbx4 antibodies against human for immunofluorescence. And from the provided pictures, it seems very good. But I am wondering if anyone use them for immunofluorescence in human cells in your memory or in published papers? And how about them? By the way, you are providing free sample size for the atf6, xbp1 antibodies, aren't you? Could you send me some for tests? One more question, do they work on endogenous proteins but not only on overexpressed proteins?
These products have been validated for use in IF on human: catalog numbers NBP1-40256, NB100-80861, and NBP1-83225. Yes these antibodies should work on the native protein/endogenous protein.
We tested WB with NBP1-83225. The MW of this item was around 80kDa in the website. But we saw the result of 60kDa. When she searched paper and the other brand's datasheet, MW of CBX4 was 60kDa. We want to know the reason the difference from yours. Could you explain about it?
The predicted molecular weight of Human CBX4 protein is 61.6kDa. There are a number of reasons why predicted protein size does not always look that way on a Western blot. One has to consider post-translational modifications, splice variants, tissue specific processing, multimer formation and amino acid charge. To confirm specificity, a control such as recombinant protein or overexpression lysate, a downregulated knockdown/knockout lysate, a peptide competition of the primary antibody, or a treatment known to effect the expression of the protein should be used.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our CBX4 Antibody - BSA Free and receive a gift card or discount.