CBX4 Antibody

Images

 
Immunohistochemistry-Paraffin: CBX4 Antibody [NBP1-83225] - Staining of human bone marrow shows strong nuclear positivity in subset of hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CBX4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBX4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CBX4 Protein (NBP1-83225PEP)
Publications
Read Publications using
NBP1-83225 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%). Reactivity reported in scientific literature (PMID: 24608790)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CBX4 Antibody

  • chromobox homolog 4 (Drosophila Pc class)
  • chromobox homolog 4
  • Chromobox protein homolog 4
  • Drosophila)
  • E3 SUMO-protein ligase CBX4
  • hPC2
  • NS5ATP1-binding protein 16
  • Pc class 2 homolog
  • PC2
  • Polycomb 2 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
2984-SE
Species: Hu
AF6270
Species: Hu
Applications: ICC

Publications for CBX4 Antibody (NBP1-83225)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CBX4 Antibody (NBP1-83225) (0)

There are no reviews for CBX4 Antibody (NBP1-83225). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CBX4 Antibody (NBP1-83225). (Showing 1 - 2 of 2 FAQs).

  1. I learn from your company web that you are providing atf6, xbp1, cbx4 antibodies against human for immunofluorescence. And from the provided pictures, it seems very good. But I am wondering if anyone use them for immunofluorescence in human cells in your memory or in published papers? And how about them? By the way, you are providing free sample size for the atf6, xbp1 antibodies, aren't you? Could you send me some for tests? One more question, do they work on endogenous proteins but not only on overexpressed proteins?
    • These products have been validated for use in IF on human: catalog numbers NBP1-40256, NB100-80861, and NBP1-83225. Yes these antibodies should work on the native protein/endogenous protein.
  2. We tested WB with NBP1-83225. The MW of this item was around 80kDa in the website. But we saw the result of 60kDa. When she searched paper and the other brand's datasheet, MW of CBX4 was 60kDa. We want to know the reason the difference from yours. Could you explain about it?
    • The predicted molecular weight of Human CBX4 protein is 61.6kDa. There are a number of reasons why predicted protein size does not always look that way on a Western blot. One has to consider post-translational modifications, splice variants, tissue specific processing, multimer formation and amino acid charge. To confirm specificity, a control such as recombinant protein or overexpression lysate, a downregulated knockdown/knockout lysate, a peptide competition of the primary antibody, or a treatment known to effect the expression of the protein should be used.

Secondary Antibodies

 

Isotype Controls

Additional CBX4 Products

Bioinformatics Tool for CBX4 Antibody (NBP1-83225)

Discover related pathways, diseases and genes to CBX4 Antibody (NBP1-83225). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBX4 Antibody (NBP1-83225)

Discover more about diseases related to CBX4 Antibody (NBP1-83225).
 

Pathways for CBX4 Antibody (NBP1-83225)

View related products by pathway.

PTMs for CBX4 Antibody (NBP1-83225)

Learn more about PTMs related to CBX4 Antibody (NBP1-83225).
 

Research Areas for CBX4 Antibody (NBP1-83225)

Find related products by research area.

Blogs on CBX4

There are no specific blogs for CBX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBX4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBX4