We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CBFA2T3 Recombinant Protein Antigen

Images

 
There are currently no images for CBFA2T3 Recombinant Protein Antigen (NBP2-56206PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CBFA2T3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CBFA2T3.

Source: E. coli

Amino Acid Sequence: SRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CBFA2T3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56206.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CBFA2T3 Recombinant Protein Antigen

  • core-binding factor, runt domain, alpha subunit 2; translocated to, 3
  • hMTG16
  • MTG16ETO2
  • MTG8-related protein 2
  • MTGR2MTG8-related gene 2
  • Myeloid translocation gene on chromosome 16 protein
  • protein CBFA2T3
  • Zinc finger MYND domain-containing protein 4
  • ZMYND4myeloid translocation gene 8 and 16b

Background

The t(16;21)(q24;q22) translocation is a rare but recurrent chromosomal abnormality associated with therapy-related myeloid malignancies. The translocation produces a chimeric gene made up of the 5'-region of the AML1 gene fused to the 3'-region of this gene. In addition, this gene is a putative breast tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene, and a brefeldin A-sensitive association of RII-alpha protein with one of the isoforms has been demonstrated in the Golgi apparatus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55747
Species: Hu
Applications: ICC/IF
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-34136
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-28863
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
AF3565
Species: Mu
Applications: IHC, IP, WB
NBP1-31362
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP3-23662
Species: Hu
Applications: Flow, ICC/IF,  IHC-P
NBP2-48693
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00006938-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-47940
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC,  IHC-P, Simple Western, WB
NBP1-97753
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
MAB7650
Species: Mu
Applications: IHC, WB
AF3540
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP2-47572
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB110-78626
Species: Hu, Mu
Applications: ChIP, Flow, ICC/IF (-), IHC,  IHC-P, IP, WB
NB600-1071
Species: Hu(-), Mu
Applications: COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, mIF, WB
NBP2-56206PEP
Species: Hu
Applications: AC

Publications for CBFA2T3 Recombinant Protein Antigen (NBP2-56206PEP) (0)

There are no publications for CBFA2T3 Recombinant Protein Antigen (NBP2-56206PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBFA2T3 Recombinant Protein Antigen (NBP2-56206PEP) (0)

There are no reviews for CBFA2T3 Recombinant Protein Antigen (NBP2-56206PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CBFA2T3 Recombinant Protein Antigen (NBP2-56206PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CBFA2T3 Products

Array NBP2-56206PEP

Blogs on CBFA2T3

There are no specific blogs for CBFA2T3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CBFA2T3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CBFA2T3