CAT3/SLC7A3 Antibody

Immunohistochemistry-Paraffin: CAT3/SLC7A3 Antibody [NBP1-88910] - Staining of human prostate shows strong positivity in myoepithelial cells.

Product Discontinued

CAT3/SLC7A3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RYQPDQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC7A3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CAT3/SLC7A3 Antibody

• ATRC3
• ATRC3cationic amino acid transporter 3
• CAT3
• CAT-3Cationic amino acid transporter y+
• FLJ14541
• MGC20687
• SLC7A3
• solute carrier family 7 (cationic amino acid transporter, y+ system), member 3
• Solute carrier family 7 member 3

Background

SLC7A3 is a member of the system y+ family of transporters characterized by sodium-independent transport of cationicamino acids.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC7A3