Recombinant Human Caspr1 Protein

Images

 
SDS-Page: Recombinant Human Caspr1 Protein [H00008506-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Caspr1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 22-131 of Human Caspr1

Source: Wheat Germ

Amino Acid Sequence: YYGCDEELVGPLYARSLGASSYYSLLTAPRFARLHGISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNSTFFGNVNESA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CNTNAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Caspr1 Protein

  • Caspr
  • Caspr1
  • CASPRcaspr1
  • CNTNAP
  • CNTNAP1
  • contactin associated protein 1
  • neurexin 4
  • Neurexin IV
  • neurexin-4
  • NRXN4contactin-associated protein 1
  • p190

Background

CNTNAP1 - contactin associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5414
Species: Hu
Applications: WB, Simple Western
AF5129
Species: Hu
Applications: WB
NBP1-62489
Species: Hu
Applications: WB
NBP2-49229
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48320
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-67704
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Caspr1 Partial Recombinant Protein (H00008506-Q01) (0)

There are no publications for Caspr1 Partial Recombinant Protein (H00008506-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspr1 Partial Recombinant Protein (H00008506-Q01) (0)

There are no reviews for Caspr1 Partial Recombinant Protein (H00008506-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caspr1 Partial Recombinant Protein (H00008506-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Caspr1 Partial Recombinant Protein (H00008506-Q01)

Discover related pathways, diseases and genes to Caspr1 Partial Recombinant Protein (H00008506-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caspr1 Partial Recombinant Protein (H00008506-Q01)

Discover more about diseases related to Caspr1 Partial Recombinant Protein (H00008506-Q01).
 

Pathways for Caspr1 Partial Recombinant Protein (H00008506-Q01)

View related products by pathway.

PTMs for Caspr1 Partial Recombinant Protein (H00008506-Q01)

Learn more about PTMs related to Caspr1 Partial Recombinant Protein (H00008506-Q01).

Blogs on Caspr1

There are no specific blogs for Caspr1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RhoA Antibody
NB100-91273

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Caspr1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CNTNAP1