Caspase-6 Antibody


Western Blot: Caspase-6 Antibody [NBP1-87684] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-100
Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining in human small intestine and skeletal muscle tissues using anti-CASP6 antibody. Corresponding CASP6 RNA-seq data are presented for the same more
Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining of human small intestine shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Caspase-6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRF
Specificity of human Caspase-6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Caspase-6 Lysate (NBP2-65003)
Control Peptide
Caspase-6 Protein (NBP1-87684PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Caspase-6 Antibody

  • Apoptotic protease Mch-2
  • CASP6
  • CASP-6
  • caspase 6, apoptosis-related cysteine peptidase
  • caspase 6, apoptosis-related cysteine protease
  • Caspase6
  • Caspase-6
  • EC 3.4.22
  • Mch2
  • MCH2EC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Caspase-6 Antibody (NBP1-87684) (0)

There are no publications for Caspase-6 Antibody (NBP1-87684).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspase-6 Antibody (NBP1-87684) (0)

There are no reviews for Caspase-6 Antibody (NBP1-87684). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caspase-6 Antibody (NBP1-87684) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Caspase-6 Products

Bioinformatics Tool for Caspase-6 Antibody (NBP1-87684)

Discover related pathways, diseases and genes to Caspase-6 Antibody (NBP1-87684). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caspase-6 Antibody (NBP1-87684)

Discover more about diseases related to Caspase-6 Antibody (NBP1-87684).

Pathways for Caspase-6 Antibody (NBP1-87684)

View related products by pathway.

PTMs for Caspase-6 Antibody (NBP1-87684)

Learn more about PTMs related to Caspase-6 Antibody (NBP1-87684).

Research Areas for Caspase-6 Antibody (NBP1-87684)

Find related products by research area.

Blogs on Caspase-6

There are no specific blogs for Caspase-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Caspase-6 Antibody and receive a gift card or discount.


Gene Symbol CASP6