Caspase-10/FLICE2 Antibody (2E7.)

Images

 
Western Blot: Caspase-10/FLICE2 Antibody (2E7) [H00000843-M02] - CASP10 monoclonal antibody (M02), clone 2E7. Analysis of CASP10 expression in U-2 OS.
Immunocytochemistry/ Immunofluorescence: Caspase-10/FLICE2 Antibody (2E7) [H00000843-M02] - Analysis of monoclonal antibody to CASP10 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Caspase-10/FLICE2 Antibody (2E7) [H00000843-M02] - Detection limit for recombinant GST tagged CASP10 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2E7.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Caspase-10/FLICE2 Antibody (2E7.) Summary

Immunogen
CASP10 (NP_116756, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQ
Specificity
CASP10 - caspase 10, apoptosis-related cysteine peptidase (2E7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CASP10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Caspase-10/FLICE2 Antibody (2E7.)

  • Apoptotic protease Mch-4
  • CASP10
  • CASP-10
  • caspase 10, apoptosis-related cysteine peptidase
  • caspase 10, apoptosis-related cysteine protease
  • Caspase10
  • Caspase-10
  • EC 3.4.22.63
  • FADD-like ICE2
  • FAS-associated death domain protein interleukin-1B-converting enzyme 2
  • FLICE2
  • ICE-like apoptotic protease 4
  • interleukin-1B-converting enzyme 2
  • Mch4
  • MCH4ALPS2

Background

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 3 and 7, and the protein itself is processed by caspase 8. Mutations in this gene are associated with apoptosis defects seen in type II autoimmune lymphoproliferative syndrome. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
126-FL/CF
Species: Hu
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP

Publications for Caspase-10/FLICE2 Antibody (H00000843-M02) (0)

There are no publications for Caspase-10/FLICE2 Antibody (H00000843-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspase-10/FLICE2 Antibody (H00000843-M02) (0)

There are no reviews for Caspase-10/FLICE2 Antibody (H00000843-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Caspase-10/FLICE2 Antibody (H00000843-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Caspase-10/FLICE2 Products

Bioinformatics Tool for Caspase-10/FLICE2 Antibody (H00000843-M02)

Discover related pathways, diseases and genes to Caspase-10/FLICE2 Antibody (H00000843-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caspase-10/FLICE2 Antibody (H00000843-M02)

Discover more about diseases related to Caspase-10/FLICE2 Antibody (H00000843-M02).
 

Pathways for Caspase-10/FLICE2 Antibody (H00000843-M02)

View related products by pathway.

PTMs for Caspase-10/FLICE2 Antibody (H00000843-M02)

Learn more about PTMs related to Caspase-10/FLICE2 Antibody (H00000843-M02).
 

Research Areas for Caspase-10/FLICE2 Antibody (H00000843-M02)

Find related products by research area.

Blogs on Caspase-10/FLICE2.

Caspase 10 - an initiator caspase in the extrinsic death receptor pathway
Apoptosis, also called programmed cell death, is an essential process in development and disease. The signaling networks that carry out apoptosis is consists of a series of endoproteases called caspases which are synthesized as inactive zymogens....  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Caspase-10/FLICE2 Antibody (2E7.) and receive a gift card or discount.

Bioinformatics

Gene Symbol CASP10
Entrez
Uniprot