Casein Kinase 1 epsilon Antibody (2E1.)

Images

 
Immunocytochemistry/ Immunofluorescence: Casein Kinase 1 epsilon Antibody (2E1) [H00001454-M07] - Analysis of monoclonal antibody to CSNK1E on HeLa cell. Antibody concentration 10 ug/ml
Proximity Ligation Assay: Casein Kinase 1 epsilon Antibody (2E1) [H00001454-M07] - Analysis of protein-protein interactions between TP53 and CSNK1E. HeLa cells were stained with anti-TP53 rabbit purified polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF, PLA
Clone
2E1.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Casein Kinase 1 epsilon Antibody (2E1.) Summary

Immunogen
CSNK1E (NP_689407, 2 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKF
Specificity
CSNK1E - casein kinase 1, epsilon (2E1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSNK1E
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Casein Kinase 1 epsilon Antibody (2E1.)

  • Casein Kinase 1 epsilon
  • casein kinase 1, epsilon
  • casein kinase I isoform epsilon
  • CKIe
  • CKI-epsilon
  • CSNK1E
  • EC 2.7.11
  • EC 2.7.11.1
  • HCKIE
  • MGC10398

Background

The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-125
Species: Hu
Applications: WB, ICC/IF
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-21376
Species: Hu
Applications: WB, IP
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF3287
Species: Hu, Mu, Rt
Applications: WB
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
H00008863-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-33534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
NBP2-19751
Species: Hu
Applications: WB

Publications for CSNK1E Antibody (H00001454-M07) (0)

There are no publications for CSNK1E Antibody (H00001454-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSNK1E Antibody (H00001454-M07) (0)

There are no reviews for CSNK1E Antibody (H00001454-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CSNK1E Antibody (H00001454-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Casein Kinase 1 epsilon Products

Bioinformatics Tool for CSNK1E Antibody (H00001454-M07)

Discover related pathways, diseases and genes to CSNK1E Antibody (H00001454-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSNK1E Antibody (H00001454-M07)

Discover more about diseases related to CSNK1E Antibody (H00001454-M07).
 

Pathways for CSNK1E Antibody (H00001454-M07)

View related products by pathway.

PTMs for CSNK1E Antibody (H00001454-M07)

Learn more about PTMs related to CSNK1E Antibody (H00001454-M07).
 

Research Areas for CSNK1E Antibody (H00001454-M07)

Find related products by research area.

Blogs on Casein Kinase 1 epsilon

There are no specific blogs for Casein Kinase 1 epsilon, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Casein Kinase 1 epsilon Antibody (2E1.) and receive a gift card or discount.

Bioinformatics

Gene Symbol CSNK1E
Entrez
Uniprot