Casein Kinase 1 delta Antibody


Western Blot: Casein Kinase 1 delta Antibody [NBP1-52975] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: Casein Kinase 1 delta Antibody [NBP1-52975] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Casein Kinase 1 delta Antibody [NBP1-52975] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Casein Kinase 1 delta Antibody Summary

Synthetic peptides corresponding to CSNK1D(casein kinase 1, delta) The peptide sequence was selected from the middle region of CSNK1D. Peptide sequence NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CSNK1D and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Casein Kinase 1 delta Antibody

  • Casein Kinase 1 delta
  • casein kinase 1, delta
  • casein kinase I isoform delta
  • CKId
  • CKI-delta
  • CSNK1D
  • EC 2.7.11
  • EC


This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is highly similar to the mouse and rat CK1 del


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, IP, PLA
Species: Hu
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC, Single Cell Western
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Casein Kinase 1 delta Antibody (NBP1-52975) (0)

There are no publications for Casein Kinase 1 delta Antibody (NBP1-52975).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Casein Kinase 1 delta Antibody (NBP1-52975) (0)

There are no reviews for Casein Kinase 1 delta Antibody (NBP1-52975). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Casein Kinase 1 delta Antibody (NBP1-52975) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Casein Kinase 1 delta Products

Bioinformatics Tool for Casein Kinase 1 delta Antibody (NBP1-52975)

Discover related pathways, diseases and genes to Casein Kinase 1 delta Antibody (NBP1-52975). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Casein Kinase 1 delta Antibody (NBP1-52975)

Discover more about diseases related to Casein Kinase 1 delta Antibody (NBP1-52975).

Pathways for Casein Kinase 1 delta Antibody (NBP1-52975)

View related products by pathway.

PTMs for Casein Kinase 1 delta Antibody (NBP1-52975)

Learn more about PTMs related to Casein Kinase 1 delta Antibody (NBP1-52975).

Research Areas for Casein Kinase 1 delta Antibody (NBP1-52975)

Find related products by research area.

Blogs on Casein Kinase 1 delta

There are no specific blogs for Casein Kinase 1 delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Casein Kinase 1 delta Antibody and receive a gift card or discount.


Gene Symbol CSNK1D