LMOD3 Antibody

Images

 
Western Blot: LMOD3 Antibody [NBP1-85898] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Skeletal muscle tissue
Immunohistochemistry-Paraffin: LMOD3 Antibody [NBP1-85898] - Analysis in human skeletal muscle and endometrium tissues using NBP1-85898 antibody. Corresponding LMOD3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: LMOD3 Antibody [NBP1-85898] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LMOD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VTDKAFKEQRDRPEAQEQSEKKISKLDPKKLALDTSFLKVSTRPSGNQTDLDGSLRRVRKNDPDMKELNLNNIENIPKEMLLDFVNAMKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMOD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
WB reported in scientific literature (PMID: 26035871). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LMOD3 Protein (NBP1-85898PEP)
Publications
Read Publication using
NBP1-85898 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26035871). Rat (80%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LMOD3 Antibody

  • DKFZp313F0135
  • leiomodin 3 (fetal)
  • Leiomodin, fetal form
  • leiomodin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4028
Species: Hu, Mu
Applications: WB
NBP1-71927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30648
Species: Hu
Applications: IHC, IHC-P

Publications for LMOD3 Antibody (NBP1-85898)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for LMOD3 Antibody (NBP1-85898) (0)

There are no reviews for LMOD3 Antibody (NBP1-85898). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMOD3 Antibody (NBP1-85898) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LMOD3 Products

Bioinformatics Tool for LMOD3 Antibody (NBP1-85898)

Discover related pathways, diseases and genes to LMOD3 Antibody (NBP1-85898). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LMOD3

There are no specific blogs for LMOD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMOD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMOD3
Entrez
Uniprot