Recombinant Human Carboxypeptidase B2/CPB2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Carboxypeptidase B2/CPB2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-110 of Human CPB2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADLIVKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYYEQYHSLNEI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CPB2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 150 mM NaCl, pH 7.5, 0.25 mM Dithiothreitol, 0.1 mM EGTA, 0.1 mM EDTA, 25% glycerol, 0.1 mM PMSF

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Carboxypeptidase B2/CPB2 Protein

  • carboxypeptidase B2 (plasma)
  • carboxypeptidase B2 (plasma, carboxypeptidase U)
  • Carboxypeptidase B2
  • Carboxypeptidase U
  • CPB2
  • CPU
  • CPUEC 3.4.17.20
  • EC 3.4.17
  • PCPB
  • Plasma carboxypeptidase B
  • TAFI
  • TAFIcarboxypeptidase B-like protein
  • Thrombin-activable fibrinolysis inhibitor
  • thrombin-activatable fibrinolysis inhibitor

Background

CPB2 - carboxypeptidase B2 (plasma, carboxypeptidase U)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2898
Species: Mu
Applications: WB, IP
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-07799
Species: Hu
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-79670
Species: Hu
Applications: WB
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NB120-11867
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
AF1267
Species: Hu
Applications: WB, IP, Neut
AF4885
Species: Mu
Applications: WB, IP
H00001361-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Carboxypeptidase B2/CPB2 Partial Recombinant Protein (H00001361-Q01) (0)

There are no publications for Carboxypeptidase B2/CPB2 Partial Recombinant Protein (H00001361-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carboxypeptidase B2/CPB2 Partial Recombinant Protein (H00001361-Q01) (0)

There are no reviews for Carboxypeptidase B2/CPB2 Partial Recombinant Protein (H00001361-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carboxypeptidase B2/CPB2 Partial Recombinant Protein (H00001361-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carboxypeptidase B2/CPB2 Products

Bioinformatics Tool for Carboxypeptidase B2/CPB2 Partial Recombinant Protein (H00001361-Q01)

Discover related pathways, diseases and genes to Carboxypeptidase B2/CPB2 Partial Recombinant Protein (H00001361-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carboxypeptidase B2/CPB2 Partial Recombinant Protein (H00001361-Q01)

Discover more about diseases related to Carboxypeptidase B2/CPB2 Partial Recombinant Protein (H00001361-Q01).
 

Pathways for Carboxypeptidase B2/CPB2 Partial Recombinant Protein (H00001361-Q01)

View related products by pathway.

PTMs for Carboxypeptidase B2/CPB2 Partial Recombinant Protein (H00001361-Q01)

Learn more about PTMs related to Carboxypeptidase B2/CPB2 Partial Recombinant Protein (H00001361-Q01).

Blogs on Carboxypeptidase B2/CPB2

There are no specific blogs for Carboxypeptidase B2/CPB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Carboxypeptidase B2/CPB2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CPB2
Entrez