Carboxypeptidase A2/CPA2 Antibody

Images

 
Immunohistochemistry: Carboxypeptidase A2/CPA2 Antibody [NBP1-87555] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carboxypeptidase A2/CPA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTTPGETAHVRVPFVNVQAVKVFLESQGIAYSI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Carboxypeptidase A2/CPA2 Protein (NBP1-87555PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carboxypeptidase A2/CPA2 Antibody

  • carboxypeptidase A2 (pancreatic)
  • Carboxypeptidase A2
  • CPA2
  • EC 3.4.17
  • EC 3.4.17.15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2898
Species: Mu
Applications: WB, IP
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-85494
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-09427
Species: Hu
NBP1-79670
Species: Hu
Applications: WB
MAB8404
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBL1-10218
Species: Hu
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Carboxypeptidase A2/CPA2 Antibody (NBP1-87555) (0)

There are no publications for Carboxypeptidase A2/CPA2 Antibody (NBP1-87555).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carboxypeptidase A2/CPA2 Antibody (NBP1-87555) (0)

There are no reviews for Carboxypeptidase A2/CPA2 Antibody (NBP1-87555). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Carboxypeptidase A2/CPA2 Antibody (NBP1-87555) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carboxypeptidase A2/CPA2 Products

Bioinformatics Tool for Carboxypeptidase A2/CPA2 Antibody (NBP1-87555)

Discover related pathways, diseases and genes to Carboxypeptidase A2/CPA2 Antibody (NBP1-87555). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carboxypeptidase A2/CPA2 Antibody (NBP1-87555)

Discover more about diseases related to Carboxypeptidase A2/CPA2 Antibody (NBP1-87555).
 

Pathways for Carboxypeptidase A2/CPA2 Antibody (NBP1-87555)

View related products by pathway.

PTMs for Carboxypeptidase A2/CPA2 Antibody (NBP1-87555)

Learn more about PTMs related to Carboxypeptidase A2/CPA2 Antibody (NBP1-87555).

Blogs on Carboxypeptidase A2/CPA2

There are no specific blogs for Carboxypeptidase A2/CPA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carboxypeptidase A2/CPA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPA2
Entrez