We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Carbohydrate Sulfotransferase 15/CHST15 Recombinant Protein Antigen

Images

 
There are currently no images for Carbohydrate Sulfotransferase 15/CHST15 Protein (NBP1-88367PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Carbohydrate Sulfotransferase 15/CHST15 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHST15.

Source: E. coli

Amino Acid Sequence: GIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVER

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHST15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88367.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Carbohydrate Sulfotransferase 15/CHST15 Recombinant Protein Antigen

  • B cell RAG associated protein (GALNAC4S-6ST)
  • B-cell RAG-associated gene protein
  • BRAG
  • BRAGKIAA0598RP11-47G11.1
  • carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15
  • Carbohydrate Sulfotransferase 15
  • CHST15
  • DKFZp781H1369
  • EC 2.8.2.33
  • GALNAC4S6ST
  • GalNAc4S-6ST
  • hBRAG
  • MGC34346
  • N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase

Background

Sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxylgroup of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containingGlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence,GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found inthrombomodulin chondroitin sulfate. May also act as a B-cell receptor involved in BCR ligation-mediated earlyactivation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAGexpression; however such results are unclear in vivo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
H00050515-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
DVE00
Species: Hu
Applications: ELISA
MAB7450
Species: Hu
Applications: IHC
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86687
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-38252
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2614
Species: Hu
Applications: CyTOF-ready, Flow, IF, IHC, IP
NBP3-48017
Species: Hu, Mu, Rt
Applications: ELISA, WB
H00001269-M01
Species: Pm, Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-80886
Species: Hu
Applications: IHC,  IHC-P
MAB3915
Species: Hu, Mu
Applications: WB
NBP2-61707
Species: Hu
Applications: ELISA, Flow, WB
NBP1-74190
Species: Mu
Applications: ChIP, WB
NBP1-82648
Species: Hu
Applications: ICC/IF,  IHC-P, WB
AF3880
Species: Hu
Applications: ICC, WB
NBP1-88367PEP
Species: Hu
Applications: AC

Publications for Carbohydrate Sulfotransferase 15/CHST15 Protein (NBP1-88367PEP) (0)

There are no publications for Carbohydrate Sulfotransferase 15/CHST15 Protein (NBP1-88367PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbohydrate Sulfotransferase 15/CHST15 Protein (NBP1-88367PEP) (0)

There are no reviews for Carbohydrate Sulfotransferase 15/CHST15 Protein (NBP1-88367PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Carbohydrate Sulfotransferase 15/CHST15 Protein (NBP1-88367PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carbohydrate Sulfotransferase 15/CHST15 Products

Blogs on Carbohydrate Sulfotransferase 15/CHST15

There are no specific blogs for Carbohydrate Sulfotransferase 15/CHST15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Carbohydrate Sulfotransferase 15/CHST15 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CHST15