Carbohydrate Sulfotransferase 15/CHST15 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Carbohydrate Sulfotransferase 15/CHST15 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHST15.
  
  

  Source: E. coli

  Amino Acid Sequence: GIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVER

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CHST15
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88367.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Carbohydrate Sulfotransferase 15/CHST15 Recombinant Protein Antigen

• B cell RAG associated protein (GALNAC4S-6ST)
• B-cell RAG-associated gene protein
• BRAG
• BRAGKIAA0598RP11-47G11.1
• carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15
• Carbohydrate Sulfotransferase 15
• CHST15
• DKFZp781H1369
• EC 2.8.2.33
• GALNAC4S6ST
• GalNAc4S-6ST
• hBRAG
• MGC34346
• N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase

Background

Sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxylgroup of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containingGlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence,GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found inthrombomodulin chondroitin sulfate. May also act as a B-cell receptor involved in BCR ligation-mediated earlyactivation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAGexpression; however such results are unclear in vivo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CHST15