Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody

Images

 
Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370] - Human kidney lysate, concentration 0.2-1 ug/ml.
Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62370] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody Summary

Immunogen
Synthetic peptides corresponding to CHST1(carbohydrate (keratan sulfate Gal-6) sulfotransferase 1) The peptide sequence was selected from the middle region of CHST1. Peptide sequence YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHST1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CHST1 and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody

  • 6-O-sulfotransferase 1
  • C6ST
  • carbohydrate (chondroitin 6/keratan) sulfotransferase 1
  • carbohydrate (keratan sulfate Gal-6) sulfotransferase 1
  • Carbohydrate Sulfotransferase 1
  • CHST1
  • EC 2.8.2
  • Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1
  • GST-1
  • Keratan sulfate Gal-6 sulfotransferase
  • KS6ST
  • KSGal6ST
  • KSGal6STEC 2.8.2.21
  • KSST

Background

CHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc struct

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59944
Species: Hu
Applications: WB
MAB7450
Species: Hu
Applications: IHC
AF5357
Species: Hu
Applications: WB, IP, Neut
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1072
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
MAB17061
Species: Mu
Applications: Neut
NBP2-20491
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7275
Species: Hu, Mu, Rt
Applications: WB
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody (NBP1-62370) (0)

There are no publications for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody (NBP1-62370).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody (NBP1-62370) (0)

There are no reviews for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody (NBP1-62370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody (NBP1-62370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carbohydrate Sulfotransferase 1/CHST1/KS6ST Products

Bioinformatics Tool for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody (NBP1-62370)

Discover related pathways, diseases and genes to Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody (NBP1-62370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody (NBP1-62370)

Discover more about diseases related to Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody (NBP1-62370).
 

Pathways for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody (NBP1-62370)

View related products by pathway.

Blogs on Carbohydrate Sulfotransferase 1/CHST1/KS6ST

There are no specific blogs for Carbohydrate Sulfotransferase 1/CHST1/KS6ST, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHST1
Entrez
Uniprot