CAPZB Antibody (4H8) - Azide and BSA Free

Western Blot: CAPZB Antibody (4H8) [H00000832-M03] - Analysis of CAPZB expression in HeLa (Cat # L013V1).

Western Blot: CAPZB Antibody (4H8) [H00000832-M03] - analysis of CAPZB expression in transfected 293T cell line by CAPZB monoclonal antibody (M03), clone 4H8. Lane 1: CAPZB transfected lysate (9 KDa). Lane 2: Non-transfected lysate.

ELISA: CAPZB Antibody (4H8) [H00000832-M03] - Detection limit for recombinant GST tagged CAPZB is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Bv
• Applications: WB, DB, ELISA
• Clone: 4H8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CAPZB Antibody (4H8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CAPZB (NP_004921, 192 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
• Specificity: CAPZB - capping protein (actin filament) muscle Z-line, beta
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CAPZB
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Dot Blot
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA. Use in Dot blot reported in scientific literature (PMID: 26344128).

Reactivity Notes

Bovine reported in scientific literature (PMID: 26344128).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CAPZB Antibody (4H8) - Azide and BSA Free

• Cap Z
• CAPB
• CAPPB
• capping protein (actin filament) muscle Z-line, beta
• CapZ beta
• CAPZ
• F-actin capping protein beta subunit
• F-actin-capping protein subunit beta
• MGC104401
• MGC129749
• MGC129750

Background

CAPZB is a member of the F-actin capping protein family. This gene encodes the beta subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CAPZB Antibody (H00000832-M03)(4)

Publications using H00000832-M03

• Gagaoua M, Terlouw EMC, Picard B. et al. The study of protein biomarkers to understand the biochemical processes underlying beef color development in young bulls. Meat Sci 2017-07-18 [PMID: 28750331]
• Gagaoua M, Terlouw EMC, Boudjellal A, Picard B. Coherent correlation networks among protein biomarkers of beef tenderness: What they reveal. Journal of proteomics 2015-10-14 [PMID: 26344128] (WB, Cytometric Bead Assay Standard, Bovine)
• Picard B, Gagaoua M, Micol D et al. Inverse relationships between biomarkers and beef tenderness according to contractile and metabolic properties of the muscle. J Agric Food Chem 2014-08-24 [PMID: 25175407]
• Guillemin N, Bonnet M, Jurie C et al. Functional analysis of beef tenderness. J Proteomics 2011-08-09 [PMID: 21855665]

Bioinformatics

• Gene Symbol: CAPZB
• Entrez:
  • 832(Human)
• OMIM:
  • 601572(Human)
• Uniprot:
  • NP_004921(Human)