CAPZB Antibody (1H1)

Images

 
Western Blot: CAPZB Antibody (1H1) [H00000832-M02] - CAPZB monoclonal antibody (M02), clone 1H1. Analysis of CAPZB expression in HeLa.
Immunohistochemistry-Paraffin: CAPZB Antibody (1H1) [H00000832-M02] - Analysis of monoclonal antibody to CAPZB on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.5 ug/ml.
Sandwich ELISA: CAPZB Antibody (1H1) [H00000832-M02] - Detection limit for recombinant GST tagged CAPZB is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
1H1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CAPZB Antibody (1H1) Summary

Immunogen
CAPZB (NP_004921 192 a.a. - 272 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
Specificity
CAPZB - capping protein (actin filament) muscle Z-line, beta (1H1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CAPZB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CAPZB Antibody (1H1)

  • Cap Z
  • CAPB
  • CAPPB
  • capping protein (actin filament) muscle Z-line, beta
  • CapZ beta
  • CAPZ
  • F-actin capping protein beta subunit
  • F-actin-capping protein subunit beta
  • MGC104401
  • MGC129749
  • MGC129750

Background

CAPZB is a member of the F-actin capping protein family. This gene encodes the beta subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86635
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02500
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80745
Species: Hu
Applications: WB, IHC, IHC-P
H00051380-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1444
Species: Mu
Applications: WB, IHC
NBP1-84620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01017
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-00955
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for CAPZB Antibody (H00000832-M02) (0)

There are no publications for CAPZB Antibody (H00000832-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAPZB Antibody (H00000832-M02) (0)

There are no reviews for CAPZB Antibody (H00000832-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAPZB Antibody (H00000832-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CAPZB Products

Bioinformatics Tool for CAPZB Antibody (H00000832-M02)

Discover related pathways, diseases and genes to CAPZB Antibody (H00000832-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAPZB Antibody (H00000832-M02)

Discover more about diseases related to CAPZB Antibody (H00000832-M02).
 

Pathways for CAPZB Antibody (H00000832-M02)

View related products by pathway.

PTMs for CAPZB Antibody (H00000832-M02)

Learn more about PTMs related to CAPZB Antibody (H00000832-M02).

Blogs on CAPZB

There are no specific blogs for CAPZB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAPZB Antibody (1H1) and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPZB
Entrez
Uniprot