CAPZB Antibody (1H1) - Azide and BSA Free

Western Blot: CAPZB Antibody (1H1) [H00000832-M02] - CAPZB monoclonal antibody (M02), clone 1H1. Analysis of CAPZB expression in HeLa.

Immunohistochemistry-Paraffin: CAPZB Antibody (1H1) [H00000832-M02] - Analysis of monoclonal antibody to CAPZB on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.5 ug/ml.

Sandwich ELISA: CAPZB Antibody (1H1) [H00000832-M02] - Detection limit for recombinant GST tagged CAPZB is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 1H1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CAPZB Antibody (1H1) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CAPZB (NP_004921, 192 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
• Specificity: CAPZB - capping protein (actin filament) muscle Z-line, beta (1H1)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CAPZB
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CAPZB Antibody (1H1) - Azide and BSA Free

• Cap Z
• CAPB
• CAPPB
• capping protein (actin filament) muscle Z-line, beta
• CapZ beta
• CAPZ
• F-actin capping protein beta subunit
• F-actin-capping protein subunit beta
• MGC104401
• MGC129749
• MGC129750

Background

CAPZB is a member of the F-actin capping protein family. This gene encodes the beta subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAPZB
• Entrez:
  • 832(Human)
• Uniprot:
  • NP_004921(Human)