CaMKK alpha Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CaMKK alpha Antibody [NBP1-88208] - CaMKK Antibody [NBP1-88208] - Staining of human cell line U-251MG shows positivity in cytoplasm. Antibody staining shown in green.

Analysis in control (vector only transfected HEK293T lysate) and CAMKK1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CaMKK alpha Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CaMKK alpha Antibody - BSA Free (NBP1-88208) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGGKSPELPGVQEDEAAS
• Predicted Species: Mouse (93%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAMKK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CaMKK alpha Antibody - BSA Free

• calcium/calmodulin-dependent protein kinase kinase 1
• calcium/calmodulin-dependent protein kinase kinase 1, alpha
• Calcium/calmodulin-dependent protein kinase kinase alpha
• CaM-kinase IV kinase
• CaM-kinase kinase 1
• CaM-kinase kinase alpha
• CaM-KK 1
• CAMKK alpha protein
• CaMKK alpha
• CaM-KK alpha
• CaMKK1
• CAMKKACaMKK 1
• DKFZp761M0423
• EC 2.7.11
• EC 2.7.11.17
• MGC34095

Background

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade. Three transcript variants encoding two distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAMKK1