CaMKII beta Antibody


Western Blot: CaMKII beta Antibody [NBP1-88212] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining of mouse somatosensory cortex shows immunoreactivity in neuronal cells bodies and dendrites.
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human cerebral cortex shows positivity in a subset of neurons.
Western Blot: CaMKII beta Antibody [NBP1-88212] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex
Immunocytochemistry/ Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining of mouse cerebellum shows positivity in neurons.
Immunocytochemistry/ Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining of mouse forebrain shows positivity in cell bodies and processes of neurons in ventral pallidum and piriform cortex.
Immunocytochemistry/ Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining of mouse medulla shows immunoreactivity in the inferior olivary nucleus and raphe obscures nucleus.
Immunocytochemistry/ Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining of mouse olfactory bulb shows positivity in neuronal cell bodies and processes in anterior olfactory nucleus.
Immunohistochemistry: CaMKII beta Antibody [NBP1-88212] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human cerebellum shows positivity in Purkinje cells as well as in molecular and granular cell layers
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human cerebral cortex shows moderate immunoreactivity in neuropil and cytoplasmic positivity in neuronal cell bodies.
Simple Western: CaMKII beta Antibody [NBP1-88212] - Simple Western lane view shows a specific band for CaMKII beta in 0.2 mg/ml of H. Motor Cortex lysate(s). This experiment was performed under reducing conditions using more
Simple Western: CaMKII beta Antibody [NBP1-88212] - Electropherogram image of the corresponding Simple Western lane view. CaMKII beta antibody was used at 1:5 dilution on H. Motor Cortex lysate(s) respectively.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P

Order Details

CaMKII beta Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH
Specificity of human, mouse CaMKII beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Simple Western 1:5
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. WB dilution: 1:100-1:500 (Rodent material) and 1:500-1:1000 (Human material). In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
CaMKII beta Protein (NBP1-88212PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CaMKII beta Antibody

  • calcium/calmodulin-dependent protein kinase (CaM kinase) II beta
  • calcium/calmodulin-dependent protein kinase II beta
  • calcium/calmodulin-dependent protein kinase type II beta chain
  • calcium/calmodulin-dependent protein kinase type II subunit beta
  • CaM kinase II beta subunit
  • CaM kinase II subunit beta
  • CaMK-II subunit beta
  • CaM-kinase II beta chain
  • EC 2.7.11
  • EC
  • MGC29528
  • proline rich calmodulin-dependent protein kinase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Species: Hu
Applications: WB, Flow, IHC-P, IP, Flow-CS
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CaMKII beta Antibody (NBP1-88212) (0)

There are no publications for CaMKII beta Antibody (NBP1-88212).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CaMKII beta Antibody (NBP1-88212) (0)

There are no reviews for CaMKII beta Antibody (NBP1-88212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CaMKII beta Antibody (NBP1-88212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CaMKII beta Products

Bioinformatics Tool for CaMKII beta Antibody (NBP1-88212)

Discover related pathways, diseases and genes to CaMKII beta Antibody (NBP1-88212). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CaMKII beta Antibody (NBP1-88212)

Discover more about diseases related to CaMKII beta Antibody (NBP1-88212).

Pathways for CaMKII beta Antibody (NBP1-88212)

View related products by pathway.

PTMs for CaMKII beta Antibody (NBP1-88212)

Learn more about PTMs related to CaMKII beta Antibody (NBP1-88212).

Research Areas for CaMKII beta Antibody (NBP1-88212)

Find related products by research area.

Blogs on CaMKII beta

There are no specific blogs for CaMKII beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CaMKII beta Antibody and receive a gift card or discount.


Gene Symbol CAMK2B