We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CaMKII beta Antibody - BSA Free

Images

 
Immunohistochemistry: CaMKII beta Antibody [NBP1-88212] - Staining of mouse brain shows moderate to strong positivity in more than 75 % of neurons in the cerebral cortex.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Analysis in human cerebral cortex and placenta tissues. Corresponding RNA-seq data are presented for the same tissues
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells
Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human heart shows weak to moderate cytoplasmic positivity in cardiomyocytes.
Simple Western: CaMKII beta Antibody [NBP1-88212] - Simple Western lane view shows a specific band for CaMKII beta in 0.2 mg/ml of H. Motor Cortex lysate(s). This experiment was performed under reducing conditions using ...read more
Simple Western: CaMKII beta Antibody [NBP1-88212] - Electropherogram image of the corresponding Simple Western lane view. CaMKII beta antibody was used at 1:5 dilution on H. Motor Cortex lysate(s) respectively.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Cerebral Cortex tissue
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

CaMKII beta Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAMK2B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:5
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in H. Motor Cortex lysates, separated by Size, antibody dilution of 1:5

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CaMKII beta Antibody - BSA Free

  • calcium/calmodulin-dependent protein kinase (CaM kinase) II beta
  • calcium/calmodulin-dependent protein kinase II beta
  • calcium/calmodulin-dependent protein kinase type II beta chain
  • calcium/calmodulin-dependent protein kinase type II subunit beta
  • CaM kinase II beta subunit
  • CaM kinase II subunit beta
  • CAM2
  • CAM2CAMK2
  • CAMKB
  • CaMKII beta
  • CaMK-II subunit beta
  • CaM-kinase II beta chain
  • EC 2.7.11
  • EC 2.7.11.17
  • MGC29528
  • proline rich calmodulin-dependent protein kinase

Background

The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Eight transcript variants encoding eight distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP2-00289
Species: Hu
Applications: Flow-CS, Flow, IHC,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB100-796
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-92440
Species: Hu
Applications: IHC,  IHC-P
NB100-1983
Species: Bv, Hu, Mu, Rt, Xp
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, RIA, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-57496
Species: Hu
Applications: ICC/IF
AF2187
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP3-16802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47405
Species: Hu
Applications: IHC,  IHC-P
NBP2-15397
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for CaMKII beta Antibody (NBP1-88212) (0)

There are no publications for CaMKII beta Antibody (NBP1-88212).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CaMKII beta Antibody (NBP1-88212) (0)

There are no reviews for CaMKII beta Antibody (NBP1-88212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CaMKII beta Antibody (NBP1-88212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CaMKII beta Products

Research Areas for CaMKII beta Antibody (NBP1-88212)

Find related products by research area.

Blogs on CaMKII beta

There are no specific blogs for CaMKII beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CaMKII beta Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CAMK2B