CaMKII beta Antibody

Western Blot: CaMKII beta Antibody [NBP1-88212] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunohistochemistry: CaMKII beta Antibody [NBP1-88212] - Staining of mouse brain shows moderate to strong positivity in more than 75 % of neurons in the cerebral cortex.

Western Blot: CaMKII beta Antibody [NBP1-88212] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Analysis in human cerebral cortex and placenta tissues. Corresponding RNA-seq data are presented for the same tissues

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human heart shows weak to moderate cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Simple Western: CaMKII beta Antibody [NBP1-88212] - Simple Western lane view shows a specific band for CaMKII beta in 0.2 mg/ml of H. Motor Cortex lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.

Simple Western: CaMKII beta Antibody [NBP1-88212] - Electropherogram image of the corresponding Simple Western lane view. CaMKII beta antibody was used at 1:5 dilution on H. Motor Cortex lysate(s) respectively.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CaMKII beta Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH
• Specificity: Specificity of human CaMKII beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAMK2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:5
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CaMKII beta Antibody

• calcium/calmodulin-dependent protein kinase (CaM kinase) II beta
• calcium/calmodulin-dependent protein kinase II beta
• calcium/calmodulin-dependent protein kinase type II beta chain
• calcium/calmodulin-dependent protein kinase type II subunit beta
• CaM kinase II beta subunit
• CaM kinase II subunit beta
• CAM2CAMK2
• CAMKB
• CaMK-II subunit beta
• CaM-kinase II beta chain
• EC 2.7.11
• EC 2.7.11.17
• MGC29528
• proline rich calmodulin-dependent protein kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAMK2B