CaM Kinase II delta Antibody - BSA Free

Immunohistochemistry-Paraffin: CaM Kinase II delta Antibody [NBP1-88211] - Staining of human heart muscle shows moderate cytoplasmic and nuclear positivity in myocytes.

Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil and neurons.

Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CaM Kinase II delta Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ
• Predicted Species: Mouse (100%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAMK2D
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CaM Kinase II delta Protein (NBP1-88211PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CaM Kinase II delta Antibody - BSA Free

• calcium/calmodulin-dependent protein kinase (CaM kinase) II delta
• calcium/calmodulin-dependent protein kinase II delta
• calcium/calmodulin-dependent protein kinase type II delta chain
• calcium/calmodulin-dependent protein kinase type II subunit delta
• CaM kinase II delta subunit
• CaM Kinase II delta
• CaM kinase II subunit delta
• CAMK2D
• CAMKD
• CaMK-II delta subunit
• CaMK-II subunit delta
• CaM-kinase II delta chain
• DKFZp686G23119
• DKFZp686I2288
• EC 2.7.11
• EC 2.7.11.17
• MGC44911

Background

The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a delta chain. Four alternatively spliced transcript variants that encode three different isoforms have been characterized to date. Distinct isoforms of this chain have different expression patterns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAMK2D