CaM Kinase II delta Antibody


Immunocytochemistry/ Immunofluorescence: CaMKII delta Antibody [NBP1-88211] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: CaMKII delta Antibody [NBP1-88211] - Staining of human heart muscle shows moderate cytoplasmic and nuclear positivity in myocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CaM Kinase II delta Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ
Specificity of human CaM Kinase II delta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CaM Kinase II delta Protein (NBP1-88211PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CaM Kinase II delta Antibody

  • calcium/calmodulin-dependent protein kinase (CaM kinase) II delta
  • calcium/calmodulin-dependent protein kinase II delta
  • calcium/calmodulin-dependent protein kinase type II delta chain
  • calcium/calmodulin-dependent protein kinase type II subunit delta
  • CaM kinase II delta subunit
  • CaM Kinase II delta
  • CaM kinase II subunit delta
  • CAMK2D
  • CaMK-II delta subunit
  • CaMK-II subunit delta
  • CaM-kinase II delta chain
  • DKFZp686G23119
  • DKFZp686I2288
  • EC 2.7.11
  • EC
  • MGC44911


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CaM Kinase II delta Antibody (NBP1-88211) (0)

There are no publications for CaM Kinase II delta Antibody (NBP1-88211).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CaM Kinase II delta Antibody (NBP1-88211) (0)

There are no reviews for CaM Kinase II delta Antibody (NBP1-88211). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CaM Kinase II delta Antibody (NBP1-88211) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CaM Kinase II delta Products

Bioinformatics Tool for CaM Kinase II delta Antibody (NBP1-88211)

Discover related pathways, diseases and genes to CaM Kinase II delta Antibody (NBP1-88211). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CaM Kinase II delta Antibody (NBP1-88211)

Discover more about diseases related to CaM Kinase II delta Antibody (NBP1-88211).

Pathways for CaM Kinase II delta Antibody (NBP1-88211)

View related products by pathway.

PTMs for CaM Kinase II delta Antibody (NBP1-88211)

Learn more about PTMs related to CaM Kinase II delta Antibody (NBP1-88211).

Research Areas for CaM Kinase II delta Antibody (NBP1-88211)

Find related products by research area.

Blogs on CaM Kinase II delta

There are no specific blogs for CaM Kinase II delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CaM Kinase II delta Antibody and receive a gift card or discount.


Gene Symbol CAMK2D