Calumenin Antibody - BSA Free

Western Blot: Calumenin Antibody [NBP2-87120] - WB Suggested Anti-CALU Antibody. Titration: 1.0 ug/ml. Positive Control: U937 Whole Cell

Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120] - Rabbit Anti-CALU Antibody. Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1:600.

Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120] - Rabbit Anti-CALU Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue. Observed Staining: Cytoplasm in follicular cells. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1:600.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Calumenin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Calumenin Antibody - BSA Free (NBP2-87120) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Calumenin. Peptide sequence: SDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALU
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Calumenin Antibody - BSA Free

• calumenin
• crocalbin
• crocalbin-like protein
• FLJ90608
• IEF SSP 9302
• multiple EF-hand protein

Background

The product of this gene is a calcium-binding protein localized in the endoplasmic reticulum (ER) and it is involved in such ER functions as protein folding and sorting. This protein belongs to a family of multiple EF-hand proteins (CERC) that include reticulocalbin, ERC-55, and Cab45 and the product of this gene. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CALU