Calsyntenin-1 Antibody

Images

 
Western Blot: CLSTN1 Antibody [NBP1-59862] - Human kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calsyntenin-1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CLSTN1(calsyntenin 1) Antibody(against the N terminal of CLSTN1. Peptide sequence KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLSTN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CLSTN1 and was validated on Western blot.
Theoretical MW
110 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Calsyntenin-1 Antibody

  • alcadein alpha 1
  • Alcadein-alpha
  • ALC-ALPHA
  • alcalpha1
  • alcalpha2
  • Alzheimer-related cadherin-like protein
  • cadherin-related family member 12
  • calsyntenin 1
  • Calsyntenin1
  • Calsyntenin-1
  • CDHR12
  • CLSTN1
  • CS1
  • CSTN1
  • FLJ32258
  • KIAA0911alcadein-alpha
  • Non-classical cadherin XB31alpha
  • non-classical cadherin XB31alpha1
  • PIK3CD
  • XB31alpha

Background

CLSTN1 induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, CLSTN1 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation. In complex with APBA2 and C99, a C-terminal APP fragment,CLSTN1 abolishes C99 interaction with PSEN1 and thus APP C99 cleavage by gamma-secretase, most probably through stabilization of the direct interaction between APBA2 and APP. The intracellular fragment AlcICD suppresses APBB1-dependent transactivation stimulated by APP C-terminal intracellular fragment (AICD), most probably by competing with AICD for APBB1-binding.CLSTN1 may modulate calcium-mediated postsynaptic signals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5480
Species: Hu
Applications: IHC
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-33116
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00009746-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-86288
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-72107
Species: Hu
Applications: Flow, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
BBA37
Species: Hu
Applications: AdBlk
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-33425
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-93790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59862
Species: Hu
Applications: WB

Publications for Calsyntenin-1 Antibody (NBP1-59862) (0)

There are no publications for Calsyntenin-1 Antibody (NBP1-59862).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calsyntenin-1 Antibody (NBP1-59862) (0)

There are no reviews for Calsyntenin-1 Antibody (NBP1-59862). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calsyntenin-1 Antibody (NBP1-59862) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calsyntenin-1 Products

Bioinformatics Tool for Calsyntenin-1 Antibody (NBP1-59862)

Discover related pathways, diseases and genes to Calsyntenin-1 Antibody (NBP1-59862). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calsyntenin-1 Antibody (NBP1-59862)

Discover more about diseases related to Calsyntenin-1 Antibody (NBP1-59862).
 

Pathways for Calsyntenin-1 Antibody (NBP1-59862)

View related products by pathway.

PTMs for Calsyntenin-1 Antibody (NBP1-59862)

Learn more about PTMs related to Calsyntenin-1 Antibody (NBP1-59862).

Blogs on Calsyntenin-1

There are no specific blogs for Calsyntenin-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calsyntenin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLSTN1
Uniprot