Calpain small subunit 1 Antibody (3C4)

Images

 
Western Blot: Calpain small subunit 1 Antibody (3C4) [H00000826-M01] - Analysis of CAPNS1 expression in transfected 293T cell line by CAPNS1 monoclonal antibody (M01), clone 3C4.Lane 1: CAPNS1 transfected lysate(28.3 ...read more
Immunocytochemistry/ Immunofluorescence: Calpain small subunit 1 Antibody (3C4) [H00000826-M01] - Analysis of monoclonal antibody to CAPNS1 on HeLa cell. Antibody concentration 20 ug/ml.
Immunohistochemistry-Paraffin: Calpain small subunit 1 Antibody (3C4) [H00000826-M01] - Analysis of monoclonal antibody to CAPNS1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Genetic Strategies: Western Blot: Calpain small subunit 1 Antibody (3C4) [H00000826-M01] - Analysis of CAPNS1 over-expressed 293 cell line, cotransfected with CAPNS1 Validated Chimera RNAi ( Cat # H00000826-R01V ...read more
Western Blot: Calpain small subunit 1 Antibody (3C4) [H00000826-M01] - CAPNS1 monoclonal antibody (M01), clone 3C4. Analysis of CAPNS1 expression in PC-12.
Western Blot: Calpain small subunit 1 Antibody (3C4) [H00000826-M01] - CAPNS1 monoclonal antibody (M01), clone 3C4 Analysis of CAPNS1 expression in A-431.
Sandwich ELISA: Calpain small subunit 1 Antibody (3C4) [H00000826-M01] - Detection limit for recombinant GST tagged CAPNS1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA, KD
Clone
3C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Calpain small subunit 1 Antibody (3C4) Summary

Immunogen
CAPNS1 (AAH00592, 172 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
Specificity
CAPNS1 - calpain, small subunit 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CAPNS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Knockdown Validated
  • Proximity Ligation Assay
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA.
Publications
Read Publications using H00000826-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calpain small subunit 1 Antibody (3C4)

  • Calcium-activated neutral proteinase small subunit
  • Calcium-dependent protease small subunit 1
  • Calcium-dependent protease small subunit
  • calcium-dependent protease, small subunit
  • calpain 4, small subunit (30K)
  • Calpain regulatory subunit
  • calpain small subunit 1
  • calpain, small polypeptide
  • calpain, small subunit 1
  • CANP
  • CANPS
  • CAPN4CALPAIN4,30K
  • CAPNS
  • CDPSCANP small subunit
  • CSS1

Background

Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. This gene encodes a small subunit common to both calpain I and II and is associated with myotonic dystrophy. Two transcript variants encoding the same protein have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88204
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-01819
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-89125
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
D6050
Species: Hu
Applications: ELISA
NBP1-32914
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
NBP1-31756
Species: Hu
Applications: ICC/IF, WB
NBP2-62708
Species: Hu
Applications: IHC, IHC-P
NBP1-88087
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF1555
Species: Hu
Applications: WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NB110-58748
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
H00000826-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA, KD

Publications for Calpain small subunit 1 Antibody (H00000826-M01)(5)

Reviews for Calpain small subunit 1 Antibody (H00000826-M01) (0)

There are no reviews for Calpain small subunit 1 Antibody (H00000826-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calpain small subunit 1 Antibody (H00000826-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calpain small subunit 1 Products

Bioinformatics Tool for Calpain small subunit 1 Antibody (H00000826-M01)

Discover related pathways, diseases and genes to Calpain small subunit 1 Antibody (H00000826-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpain small subunit 1 Antibody (H00000826-M01)

Discover more about diseases related to Calpain small subunit 1 Antibody (H00000826-M01).
 

Pathways for Calpain small subunit 1 Antibody (H00000826-M01)

View related products by pathway.

PTMs for Calpain small subunit 1 Antibody (H00000826-M01)

Learn more about PTMs related to Calpain small subunit 1 Antibody (H00000826-M01).
 

Research Areas for Calpain small subunit 1 Antibody (H00000826-M01)

Find related products by research area.

Blogs on Calpain small subunit 1

There are no specific blogs for Calpain small subunit 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calpain small subunit 1 Antibody (3C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPNS1
Entrez
OMIM
Uniprot